The URL can be used to link to this page

Item 3 - Staff Report with Exhibits 1 through 12.17400 Wedgewood PREPARED BY: Ryan Safty Associate Planner Reviewed by: Planning Manager and Community Development Director 110 E. Main Street Los Gatos, CA 95030 ● (408) 354-6872 www.losgatosca.gov TOWN OF LOS GATOS PLANNING COMMISSION REPORT MEETING DATE: 08/13/2025 ITEM NO: 3 DATE: August 8, 2025 TO: Planning Commission FROM: Joel Paulson, Community Development Director SUBJECT: Consider a Request for a Grading Permit and Removal of Large Protected Trees Associated with a Comprehensive Redevelopment of the La Rinconada Golf Course on Property Zoned RC and R-1:20. Located at 14595 Clearview Drive, 17400 Wedgewood Avenue, and 17445 Zena Avenue. APNs 409-18- 008, -009, -010, and 409-31-001. Architecture and Site Application S-25-005. Categorically Exempt Pursuant to CEQA Guidelines Sections 15301: Existing Facilities, and 15302: Replacement or Reconstruction. Property Owner: Clearview Golf Associates LLC. Applicant: Andy Kimball. Project Planner: Ryan Safty. RECOMMENDATION: Consider a request for a Grading Permit and removal of Large Protected Trees associated with a comprehensive redevelopment of the La Rinconada Golf Course on property zoned RC and R- 1:20, located at 14595 Clearview Drive, 17400 Wedgewood Avenue, and 17445 Zena Avenue. PROJECT DATA: General Plan Designation: Open Space Current Zoning Designation: R-1:20 – Single Family Residential, and RC – Resource Conservation Applicable Plans and Standards: General Plan, Town Code Parcel Size: 118.4 acres Page 257 PAGE 2 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 Surrounding Area: CEQA: The project is Categorically Exempt pursuant to the adopted Guidelines for the Implementation of the California Environmental Quality Act, Sections 15301: Existing Facilities, and 15302: Replacement or Reconstruction. FINDINGS:  The project is Categorically Exempt pursuant to the adopted Guidelines for the Implementation of the California Environmental Quality Act, Sections 15301: Existing Facilities, and 15302: Replacement or Reconstruction.  The project meets the objective standards of Chapter 29 of the Town Code (Zoning Regulations). CONSIDERATIONS:  As required by Section 29.20.150 of the Town Code for granting approval of an Architecture and Site application. ACTION: The decision of the Planning Commission is final unless appealed within ten days. BACKGROUND: The subject property includes the La Rinconada Country Club and golf course occupying approximately 118.4 acres across several different parcels. The golf course is located south of Highway 85 and west of Winchester Boulevard, with access along Wedgewood Avenue, Clearview Drive, and Zena Avenue (Exhibit 1). The golf course has been in operation at this location for nearly 100 years and presently includes a full 18-hole golf course, driving range, practice greens, maintenance facility, clubhouse, pool, and fitness facility. Existing Land Use General Plan Zoning North Residential Low Density Residential R-1:8 South Residential Monte Sereno Monte Sereno East Residential Low and Medium Density Residential R-1:12, R-1:12:PD West Residential, Water Treatment Plant Low Density Residential, Monte Sereno R-1:10, R-1:20, R- 1:20:PD, Monte Sereno Page 258 PAGE 3 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 The applicant submitted an Architecture and Site application to modernize the 18-hole layout, with site work requiring a Grading Permit, and removal of 287 trees, 16 of which are considered Large Protected. Several holes would be realigned, the fairway contours refined, and new bunkers and greens installed throughout the course. The redevelopment of the golf course requires a large amount of grading across the site, but the grading is designed to be balanced on-site to minimize truck hauling. Cart paths and the entry drive off Clearview Drive would be redesigned, and a new 250-square-foot restroom and comfort station would be added. Existing fairway grass would be replaced with more drought tolerant Bermuda grasses, with updated irrigation systems, and new trees would be planted to better suit the climate and modernization plan (Exhibit 5). Grading Permits, and associated Architecture and Site applications, and Large Protected Tree removals do not automatically trigger Planning Commission approval; however, due to the size of the project, amount of tree removals, grading quantities, and exceptions requested to the tree fencing and tree replacement requirements, this application is being forwarded to the Planning Commission for approval. PROJECT DESCRIPTION: A. Location and Surrounding Neighborhood The subject property is a golf course and country club that occupies approximately 118.4 acres and spans several different parcels. The golf course is located south of Highway 85 and west of Winchester Boulevard, with access along Wedgewood Avenue, Clearview Drive, and Zena Avenue (Exhibit 1). Single-family residential development surrounds the property on all sides, with the Rinconada Water Treatment Plant located along a portion of the western border of the site. B. Project Summary The applicant proposes a comprehensive redevelopment of the golf course, requiring a Grading Permit, removal of Large Protected Trees, and construction of a new restroom comfort station (Exhibit 5). C. Zoning Compliance The golf course and country club operates under an approved Conditional Use Permit (CUP), which was most recently amended in 2011 (Exhibit 4). The golf course modifications proposed with this Architecture and Site application would not affect the applicable conditions of approval tied to their CUP. Page 259 PAGE 4 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 DISCUSSION: A. Architecture and Site Analysis The applicant proposes a comprehensive redevelopment of the golf course, which includes a modernization of the 18-hole course, site grading, tree removal, construction of a new comfort station, and new vehicular entrance. Details of each of these components are provided below. The existing club house building and other on-site structures are not a part of this application. Golf Course Modernization The overarching goal behind this application, as noted in Exhibit 5, is to redevelop and modernize the existing 18-hole golf course. The golf course has been operating in its current configuration since the early 1990’s. As noted in Exhibit 5, golf courses typically require major rehabilitation every 30 years because fairway grasses become compromised and irrigation and drainage begin to fail. The existing 18-hole layout would be slightly modified in terms of the locations of each hole, and would include refined fairway contours, new bunkers, new greens throughout the course, and slight modifications to the existing water features. Drainage and irrigation would be updated, and cart paths would be modified and substantially reduced throughout the course. In addition to the course greens, site landscaping would be updated as well (Exhibit 11). Grading To facilitate the course modernization, the associated site work requires approval of an Architecture and Site approval for a Grading Permit. The proposed grading is for the reconfiguration of the course, and would result in a total of 52,300 cubic yards of cut and 52,300 cubic yards of fill (Sheet A0-10, Exhibit 11). No off haul or importing of native soil is anticipated for this project. Maximum proposed cut depth would be approximately 10 feet (near Holes 11 and 16) and maximum proposed fill depth would be approximately 10 feet (near Holes 7, 8 and 16). As this project is not located within the Hillside Area, compliance with the Hillside Development Standards and Guidelines for maximum cut and fill depth is not applicable. Justification for the project grading is provided in Exhibit 5. Page 260 PAGE 5 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 Tree Removal The existing 118.4-acre property contains over 1,200 trees. The applicant submitted an arborist report (Exhibit 6), which tagged and surveyed 945 trees within the project area. This arborist report was peer reviewed by the Town’s Consulting Arborist (Exhibit 7), and the applicant provided a response in Exhibit 8, and updated their report. The applicant proposes removal of 287 protected trees as a part of this project. The arborist report included as Exhibit 6 identifies 240 trees that require removal based on proposed construction activities, as well as another 47 trees that are recommended for removal based on current health, condition, and safety ratings. These additional 47 trees are identified as “HR” (Hazard Removal) within Exhibit 6 and the project plans (Exhibit 11) and are generally located along the perimeter of the golf course. Of the 287 trees proposed for removal, eight are considered exempt based on the species and size, and 16 are considered Large Protected Trees. Most of the Large Protected Tree removals (14 of the 16) are eucalyptus trees, which are known to be a fire risk. The Consulting Arborist reviewed the applicant’s arborist report and agreed with the list of 287 trees proposed for removal. The applicant provided detailed justification for the removals in Exhibit 5. In summary, the applicant notes that a critical element of the modernization project is to reduce water usage by planting new drought tolerant Bermuda grass and native trees that are better equipped to thrive in this climate. Many of the existing trees were planted over the past 60 years to separate the fairways and are non-native. The new drought tolerant Bermuda grass needs more sunlight to grow, and the current tree locations and heights are creating narrow fairways and excessive shading. Over the past few years, over 100 trees have fallen on the course either due to storms or drought. The majority of the proposed removals (150 out of 287) are Coast Redwoods, which require excessive watering that can no longer be supported, and eucalyptus trees (47 out of 287). Tree Replacement Town Code requires tree replacements for each protected tree proposed for removal. Based on the canopy size of the 287 trees proposed for removal, a total of 977 24-inch box trees (or 489 36-inch box trees) must be replanted on-site. For each of the 977 trees not proposed to be replaced, Town Code allows the applicant to pay an in-lieu fee to the Town’s Tree Replacement Fund. The applicant is proposing a reforestation plan that includes replanting 173 native trees, most of which would be oak trees (121 out of 173). The majority of the proposed replacements would exceed the standard 24-inch box replacement standard, with 66 of them being 48-inch box and 26 being 60-inch box trees. Town Code treats a 36-inch box trees as counting for two 24-inch box trees, but does not specify how to treat a 48-inch or Page 261 PAGE 6 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 60-inch box tree. Working with the Town Arborist and Consulting Arborist, staff would consider a 48-inch box tree as three 24-inch box trees and a 60-inch box tree as four 24-inch box trees. Based on these determinations, the proposed reforestation plan would be short 538 trees and would require an in-lieu fee payment of $134,500. The applicant attests that these larger trees should count more towards the replacement requirement, which would reduce the in-lieu fee total. The Planning Commission has the authority to increase the value of the 48- and 60-inch box trees, and also decrease the required tree in-lieu fees. The tables below outline the applicant’s replacement calculation compared to staff’s. Tree Protection The applicant and their arborist have prepared tree protection plans (Exhibit 11, TP Sheets) to ensure protection of the 658 trees that would be preserved on the site. The tree protection plans show that Town standard Type I protection, with six-foot tall chain-link fencing, is proposed for all trees in high-impact areas. For trees in areas deemed to have low to no construction impact, the applicant is proposing to use orange plastic fencing. The applicant has provided detailed justification for this exception request within Exhibit 5, detailing the cost savings associated with fencing a property of this size. The Consulting Arborist reviewed the request and noted that this option will need to be discussed and approved by staff and that one option is to have regular monitoring of the fence in-lieu of Page 262 PAGE 7 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 the sturdier chain-link fencing (Exhibit 7). The Town Arborist also reviewed this request and stated that this type of request has been supported in the past on larger projects. Staff has included Condition of Approval 9 within Exhibit 3 requiring monthly monitoring of the alternative fencing materials. Accessory Building As a part of the modernization and update plan for the property, a new 250-square foot comfort station is proposed on the site, between Holes 10 and 18 (Exhibit 11). The proposed comfort station includes two restrooms and a beverage station. The building would be approximately 13 feet tall and would include a tile roof and a mixture of stucco and stone veneer siding to match the club house. New Vehicular Entrance The modernization plan also includes a modified and realigned vehicular entry accessed via Clearview Drive, which serves as the primary public entrance to the property (Exhibit 11). The new entrance drive would be substantially in the same location, would be 22 feet wide, compliant with Town Code, and would require 480 cubic yards of grading. B. Environmental Review The applicant hired David J. Powers & Associates, Inc. to prepare a California Environmental Quality Act (CEQA) analysis on the proposed redevelopment plan. As provided in Exhibit 9, a noise study, construction emissions and health risk assessment, and biology report were conducted, concluding that, with implementation of the draft conditions of approval in Exhibit 3, the project is categorically exempt from CEQA per Sections 15301 (Existing Facilities) and 15302 (Replacement or Reconstruction). PUBLIC COMMENTS: Story poles and signage were installed on the site along three street frontages and written notice was sent to property owners and tenants located within 300 feet of the subject property. The applicant has also conducted substantial neighborhood outreach, including sending seven separate letters to all properties within 300 feet and hosting six different open house events. A summary of this neighborhood outreach is provided in Exhibit 10. Public comments received by 11:00 a.m., August 8, 2025, are provided in Exhibit 12. Page 263 PAGE 8 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 CONCLUSION: A. Summary The applicant is requesting approval of an Architecture and Site application, Grading Permit, and removal of Large Protected Trees associated with a comprehensive redevelopment and modernization plan for the La Rinconada Golf Course. The project grading would include 52,300 cubic yards of cut and 52,300 cubic yards of fill, balancing the dirt on-site. A total of 287 trees are proposed for removal, including 16 Large Protected Trees. The tree removal would be offset through replacement plantings and payment of in-lieu fees. B. Recommendation Staff recommends that the Planning Commission consider the request and, if merit is found with the proposed project, take the following steps to approve the Architecture and Site application and Large Protected Tree removals: 1. Find that the proposed project is Categorically Exempt pursuant to the adopted Guidelines for the implementation of the California Environmental Quality Act, Section 15301: Existing Facilities, and Section 15302: Replacement or Reconstruction (Exhibit 2); 2. Make the finding that the project complies with the objective standards of Chapter 29 of the Town Code (Zoning Regulations) (Exhibit 2); 3. Make the considerations as required by Section 29.20.150 of the Town Code for granting approval of an Architecture and Site application (Exhibit 2); and 4. Approve Architecture and Site application S-25-005 with the conditions contained in Exhibit 3 and the development plans in Exhibit 11. C. Alternatives Alternatively, the Commission can: 1. Continue the matter to a date certain with specific direction; or 2. Approve the application with additional and/or modified conditions; or 3. Deny the application. Page 264 PAGE 9 OF 9 SUBJECT: 14595 Clearview Drive, 17400 Wedgewood Avenue, 17445 Zena Ave/S-25-005 DATE: August 8, 2025 EXHIBITS: 1. Location Map 2. Required Findings and Considerations 3. Recommended Conditions of Approval 4. 2011 Conditional Use Permit 5. Project Description and Letter of Justification 6. Applicant Arborist Report 7. Consulting Arborist Peer Review 8. Applicant Response to Consulting Arborist Peer Review 9. CEQA Memorandum and Studies 10. Neighborhood Outreach Summary 11. Project Plans 12. Public comments received by 11:00 a.m., Friday, August 8, 2025 Page 265 This Page Intentionally Left Blank Page 266 WEDGEWOOD AV EATON LN WINCHESTER BLSB HI G H W A Y 8 5 NB HIGH W A Y 8 5 KARL AVZENA AV BICKNELL RD LA R INCONADA DRWIMB LEDON DR CLEARVIEW DR UNIVERSITY AVCLARA STEASTVIEW DRPRINCE STP O L L A R D R D GRA N A D A W Y LORA DR ROXBURY LNNEWELL AV PAL M E R D R WIL D W Y ASH CT ELENA WYBROCASTLE WYKARL AV 14595 Clearview Drive, 17400 Wedgewood Avenue, and 17445 Zena Avenue 0 0.250.125 Miles ° Update Notes:- Updated 12/20/17 to link to tlg-sql12 server data (sm)- Updated 11/22/19 adding centerpoint guides, Buildings layer, and Project Site leader with label- Updated 10/8/20 to add street centerlines which can be useful in the hillside area- Updated 02-19-21 to link to TLG-SQL17 database (sm)- Updated 08-23-23 to link to "Town Assessor Data" (sm) EXHIBIT 1 Page 267 This Page Intentionally Left Blank Page 268 C:\Users\MeetingsOfficeUser13\AppData\Local\Temp\tmp6C5A.tmp PLANNING COMMISSION – August 13, 2025 FINDINGS AND CONSIDERATIONS 14595 Clearview Drive, 17400 Wedgewood Avenue, and 17445 Zena Avenue Architecture and Site Application S-25-005 Consider a Request for a Grading Permit and Removal of Large Protected Trees Associated with a Comprehensive Redevelopment of the La Rinconada Golf Course on Property Zoned RC and R-1:20. APNs 409-18-008, -009, -010, and 409-31-001. Categorically Exempt Pursuant to the California Environmental Quality Act (CEQA) Guidelines, Section 15301: Existing Facilities, and 15302: Replacement or Reconstruction. Property Owner: Clearview Golf Associates LLC. Applicant: Andy Kimball. FINDINGS Required finding for CEQA: ■ The project is Categorically Exempt pursuant to the adopted Guidelines for the Implementation of the California Environmental Quality Act, Section 15301: Existing Facilities, and Section 15302: Replacement or Reconstruction. Required compliance with the Zoning Regulations: ■ The project meets the objective standards of Chapter 29 of the Town Code (Zoning Regulations). CONSIDERATIONS Required considerations in review of Architecture and Site applications: ■ As required by Section 29.20.150 of the Town Code, the considerations in review of an Architecture and Site application were all made in reviewing this project. EXHIBIT 2 Page 269 This Page Intentionally Left Blank Page 270 PLANNING COMMISSION – August 13, 2025 DRAFT CONDITIONS OF APPROVAL 14595 Clearview Drive, 17400 Wedgewood Avenue, and 17445 Zena Avenue Architecture and Site Application S-25-005 Consider a Request for a Grading Permit and Removal of Large Protected Trees Associated with a Comprehensive Redevelopment of the La Rinconada Golf Course on Property Zoned RC and R-1:20. APNs 409-18-008, -009, -010, and 409-31-001. Categorically Exempt Pursuant to the California Environmental Quality Act (CEQA) Guidelines, Section 15301: Existing Facilities, and 15302: Replacement or Reconstruction. Property Owner: Clearview Golf Associates LLC. Applicant: Andy Kimball. TO THE SATISFACTION OF THE DIRECTOR OF COMMUNITY DEVELOPMENT: Planning Division 1. APPROVAL: This application shall be completed in accordance with all of the conditions of approval and in substantial compliance with the approved plans. Any changes or modifications to the approved plans and/or business operation shall be approved by the Community Development Director, DRC or the Planning Commission depending on the scope of the changes. 2. EXPIRATION: The approval will expire two years from the approval date pursuant to Section 29.20.320 of the Town Code, unless the approval has been vested. 3. OUTDOOR LIGHTING: Exterior lighting shall be kept to a minimum, and shall be down directed fixtures that will not reflect or encroach onto adjacent properties. No flood lights shall be used unless it can be demonstrated that they are needed for safety or security. The lighting plan shall be reviewed during building plan check. 4. EXISTING TREES: All existing trees shown on the plan and trees required to remain or to be planted are specific subjects of approval of this plan, and must remain on the site. 5. TREE REMOVAL PERMIT: A Tree Removal Permit shall be obtained for any trees to be removed, prior to the issuance of a Building or Grading Permit. 6. ARBORIST REQUIREMENTS: The developer shall implement, at their cost, all recommendations made by Trees 360 and Richard Gessner, identified in the Arborist reports, dated July 17, 2025, on file in the Community Development Department. A Compliance Memorandum shall be prepared by the applicant and submitted with the building permit application detailing how the recommendations have or will be addressed. These recommendations must be incorporated in the building permit plans, and completed prior to issuance of a building permit where applicable. 7. TREE FENCING: Protective tree fencing shall be installed in accordance with the approved landscape plans and as noted in the July 17, 2025, arborist report, unless as modified by the Planning Commission. A tree protection fencing plan shall be included with the construction plans. EXHIBIT 3 Page 271 8. REPLACEMENT TREES: New trees shall be planted to mitigate the loss of trees being removed. The number of trees and size of replacement trees shall be planted in accordance to the table below. New trees shall be double staked with rubber ties and shall be planted prior to final inspection and issuance of occupancy permits. In-lieu fees, pursuant to Town Code, shall be paid to mitigate the replacement of any trees not planted per Town Code. 9. ARBORIST MONITORING: Anytime tree protection fencing and netting is to be constructed or moved, the project arborist shall be on-site to monitor the work and ensure compliance with tree protection plan. If plastic netting is approved in lieu of chain-link fencing, the project arborist shall inspect the fencing and submit a report to the Community Development Department monthly. 10. TREE STAKING: All newly planted trees shall be double-staked using rubber tree ties. 11. WATER EFFICIENCY LANDSCAPE ORDINANCE: The final landscape plan, including landscape and irrigation plans and calculations, shall meet the Town of Los Gatos Water Conservation Ordinance or the State Water Efficient Landscape Ordinance, whichever is more restrictive. The final landscape plan shall be reviewed by the Town’s consultant prior to issuance of building permits. A review fee based on the current fee schedule adopted by the Town Council is required when working landscape and irrigation plans are submitted for review. 12. PROPERTY FENCE: All new fencing shall comply with Town Code Section 29.40.0315 at building permit stage, unless an exception is granted by the Community Development Director. 13. STORY POLES: The story poles and project signs on the project site shall be removed within 30 days of approval of the Architecture and Site application. 14. BAAQMD MEASURES: During any construction period ground disturbance, the applicant shall ensure that the project contractor implements measures to control dust and exhaust. Implementation of the measures recommended by BAAQMD and listed below would reduce the air quality impacts associated with grading and new construction to a less-than-significant level. a. All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day. b. All haul trucks transporting soil, sand, or other loose material off-site shall be covered. c. All visible mud/dirt track-out onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day. The use of dry power sweeping is prohibited. d. All vehicle speeds on unpaved roads shall be limited to 15 miles per hour (mph). e. All roadways, driveways, and sidewalks to be paved shall be completed as soon as Page 272 practicable. Building pads shall be laid as soon as practicable after grading unless seeding or soil binders are used. f. All excavation, grading, and/or demolition activities shall be suspended when average wind speeds exceed 20 mph. g. All trucks and equipment, including their tires, shall be washed off prior to leaving the site. h. Unpaved roads providing access to site located 100 feet of further from a paved road shall be treated with a six - to 12-inch layer of compacted layer of wood chips, mulch, or gravel. i. Publicly visible signs shall be posted with the telephone number and name of the person to contact at the lead agency regarding dust complaints. This person shall respond and take corrective action within 48 hours. The Air District’s General Air Pollution Complaints number shall be visible to ensure compliance with applicable regulations. 15. CONSTRUCTION ACTIVITIES: To limit the presence of noise during construction, the following shall be complied with during any construction, grading, or tree removals. a. Construction activities shall be limited to the hours of 8:00 a.m. to 6:00 pm on weekdays and between the hours of 9:00 am and 4:00 pm on Saturdays. No construction is permitted on Sundays or holidays. b. Equip all internal combustion engine-driven equipment with intake and exhaust mufflers that are in good condition and appropriate for the equipment. c. Prohibit unnecessary idling of internal combustion engines. d. Locate stationary noise-generating equipment, such as air compressors or portable power generators, as far as possible from sensitive receptors as feasible. If they must be located near receptors, adequate muffling (with enclosures where feasible and appropriate) shall be used to reduce noise levels at the adjacent sensitive receptors. Any enclosure openings or venting shall face away from sensitive receptors. e. Locate construction staging areas at locations that will create the greatest distance between the construction-related noise sources and noise-sensitive receptors nearest the project site during all project construction. f. Locate material stockpiles, as well as maintenance/equipment staging and parking areas, as far as feasible from residential receptors. g. Designate a "disturbance coordinator" who would be responsible for responding to any complaints about construction noise. The disturbance coordinator will determine the cause of the noise complaint (e.g., bad muffler, etc.) and will require that reasonable measures be implemented to correct the problem. Conspicuously post a telephone number for the disturbance coordinator at the construction site and include in it the notice sent to neighbors regarding the construction schedule. 16. CONSTRUCTION VIBRATION: To limit the presence of vibration during construction, the following shall be complied with during any construction, grading, or tree removals. a. Smaller equipment (less than 18,000 pounds) shall be used near the property lines adjacent to the residential buildings to minimize vibration levels. For example, a smaller vibratory roller similar to a Caterpillar model CP433E vibratory compactor could be used when compacting materials within 25 feet of vibration-sensitive Page 273 buildings. b. Small tractors/loaders/backhoes shall be used within 10 feet of vibration-sensitive buildings instead of excavators. c. Designate a Disturbance Coordinator responsible for registering and investigating claims of excessive vibration. The contact information of such person shall be clearly posted on the construction site. 17. NESTING BIRDS: To avoid impacts to nesting birds, the removal of trees and shrubs shall be minimized to the greatest extent feasible. Construction activities that include any tree removal, pruning, grading, grubbing, or demolition shall be conducted outside of the bird nesting season (January 15 through September 15) to the greatest extent feasible. If this type of construction starts, if work is scheduled to start or if work already occurring during the nesting season stops for at least two weeks and is scheduled to resume during the bird nesting season, then a qualified biologist shall conduct a pre- construction surveys for nesting birds to ensure that no nests would be disturbed during project construction. If project-related work is scheduled during the nesting season (February 15 to August 30 for small bird species such as passerines; January 15 to September 15 for owls; and February 15 to September 15 for other raptors), a qualified biologist shall conduct nesting bird surveys. Two surveys for active nests of such birds shall occur within 14 days prior to start of construction, with the second survey conducted with 48 hours prior to start of construction. Appropriate minimum survey radius surrounding each work area is typically 250 feet for passerines, 500 feet for smaller raptors, and 1,000 feet for larger raptors. Surveys shall be conducted at the appropriate times of day to observe nesting activities. If the qualified biologist documents active nests within the project site or in nearby surrounding areas, an appropriate buffer between each nest and active construction shall be established. The buffer shall be clearly marked and maintained until the young have fledged and are foraging independently. Prior to construction, the qualified biologist shall conduct baseline monitoring of each nest to characterize “normal” bird behavior and establish a buffer distance, which allows the birds to exhibit normal behavior. The qualified biologist shall monitor the nesting birds daily during construction activities and increase the buffer if birds show signs of unusual or distressed behavior (e.g. defensive flights and vocalizations, standing up from a brooding position, and/or flying away from the nest). If buffer establishment is not possible, the qualified biologist or construction foreman shall have the authority to cease all construction work in the area until the young have fledged and the nest is no longer active. 18. SPECIAL-STATUS BATS: Approximately 14 days prior to tree removal or structure demolition activities, a qualified biologist shall conduct a habitat assessment for bats and potential roosting sites in trees to be removed, in trees within 50 feet of the development footprint, and within and surrounding any structures that may be disturbed by the project. These surveys will include a visual inspection of potential roosting features (bats need not be present) and a search for presence of guano within the project site, construction access routes, and 50 feet around these areas. Cavities, crevices, exfoliating bark, and bark fissures that could provide suitable potential nest or roost habitat for bats shall be surveyed. Assumptions can be made on what species is present due to observed visual characteristics along with habitat use, or the bats can be Page 274 identified to the species level with the use of a bat echolocation detector such as an “Anabat” unit. Potential roosting features found during the survey shall be flagged or marked. If no roosting sites or bats are found, a letter report confirming absence will be prepared and no further measures are required. If bats or roosting sites are found, a letter report and supplemental documents will be prepared prior to grading permit issuance and the following monitoring, exclusion, and habitat replacement measures will be implemented: a. If bats are found roosting outside of the nursery season (May 1 through October 1), they will be evicted as described under (b) below. If bats are found roosting during the nursery season, they will be monitored to determine if the roost site is a maternal roost. This could occur by either visual inspection of the roost bat pups, if possible, or by monitoring the roost after the adults leave for the night to listen for bat pups. If the roost is determined to not be a maternal roost, then the bats will be evicted as described under (b) below. Because bat pups cannot leave the roost until they are mature enough, eviction of a maternal roost cannot occur during the nursery season. Therefore, if a maternal roost is present, a 50-foot buffer zone (or different size if determined in consultation with the CDFW) will be established around the roosting site within which no construction activities including tree removal or structure disturbance will occur until after the nursery season. b. If a non-breeding bat hibernaculum is found in a tree or snag scheduled for removal or on any structures scheduled to be disturbed by project activities, the individuals will be safely evicted, under the direction of a qualified bat biologist. If pre- construction surveys determine that there are bats present in any trees to be removed, exclusion structures (e.g. one-way doors or similar methods) shall be installed by a qualified biologist. The exclusion structures shall not be placed until the time of year in which young are able to fly, outside of the nursery season. Information on placement of exclusion structures shall be provided to the CDFW prior to construction. If needed, other methods conducted under the direction of a qualified bat biologist could include: carefully opening the roosting area in a tree or snag by hand to expose the cavity and opening doors/windows on structures, or creating openings in walls to allow light into the structures. Removal of any trees or snags and disturbance of any structures will be conducted no earlier than the following day (i.e., at least one night will be provided between initial roost eviction disturbance and tree removal/structure disturbance). This action will allow bats to leave during dark hours, which increases their chance of finding new roosts with a minimum of potential predation. 19. ARCHAEOLOGICAL RESOURCES AND HUMAN REMAINS: a. In the event that archaeological traces are encountered, all construction within a 50-meter radius of the find will be halted, the Community Development Director will be notified, and an archaeologist will be retained to examine the find and make appropriate recommendations. Page 275 b. If human remains are discovered, the Santa Clara County Coroner will be notified. The Coroner will determine whether or not the remains are Native American. If the Coroner determines the remains are not subject to his authority, he will notify the Native American Heritage Commission, who shall attempt to identify descendants of the deceased Native Americans. c. If the Community Development Director finds that the archaeological find is not a significant resource, work will resume only after the submittal of a preliminary archaeological report and after provisions for reburial and ongoing monitoring are accepted. Provisions for identifying descendants of a deceased Native American and for reburial will follow the protocol set forth in CEQA Guidelines Section 15064.5( e). If the site is found to be a significant archaeological site, a mitigation program will be prepared and submitted to the Community Development Director for consideration and approval, in conformance with the protocol set forth in Public Resources Code Section 21083.2. d. A final report shall be prepared when a find is determined to be a significant archaeological site, and/or when Native American remains are found on the site. The final report will include background information on the completed work, a description and list of identified resources, the disposition and curation of these resources, any testing, other recovered information, and conclusions. 20. DUSKY-FOOTED WOODRATS: This project will implement the following standard measures to minimize impacts on woodrats and active woodrat nests on the project site. a. PRECONSTRUCTION SURVEY. A qualified biologist will conduct a preconstruction survey for San Francisco dusky-footed woodrat nests within 30 days of the start of work activities. If active woodrat nests are determined to be present in, or within 10 feet of the impact areas, the conditions below (Avoidance and/or Nest Relocation) will be implemented, as appropriate. If no active woodrat nests are present on or within 10 feet of impact areas, no further conditions are warranted. b. AVOIDANCE. Active woodrat nests that are detected within the work area wil be avoided to the extend feasible. Ideally, a minimum 10-foot buffer will be maintained between project activities and woodrat nests to avoid disturbance. In some situations, a small buffer may be allowed if, in the opinion of a qualified biologist, nest relocation (below) would represent a greater disturbance to the woodrats than the adjacent work activities. c. NEST RELOCATION. If avoidance of active woodrat nests within and immediately adjacent to (within 10 feet of) the work areas is not feasible, then nest materials will be relocated to suitable habitat as close to the project site as possible (ideally, within or immediately adjacent to the project site). Relocation efforts will avoid the peak nesting season (February-July) to the maximum extent feasible. Prior to the start of construction activities, a qualified biologist will disturb the woodrat nest to the degree that all woodrats leave the nest and seek refuge outside of the construction area. Disturbance of the woodrat nest will be initiated no earlier than one hour before dusk to prevent the exposure of woodrats to diurnal predators. Subsequently, the biologist will dismantle and relocate the nest material by hand. During the deconstruction process, the biologist will attempt to assess if there are Page 276 juveniles in the nest. If immobile juveniles are observed, the deconstruction process will be discontinued until a time when the biologist believes the juveniles will be capable of independent survival (typically after 2 to 3 weeks). A no-disturbance buffer will be established around the nest until the juveniles are mobile. The nest may be dismantled once the biologist has determined that adverse impacts on the juveniles would not occur. 21. TOWN INDEMNITY: Applicants are notified that Town Code Section 1.10.115 requires that any applicant who receives a permit or entitlement (“the Project”) from the Town shall defend (with counsel approved by Town), indemnify, and hold harmless the Town, its agents, officers, and employees from and against any claim, action, or proceeding (including without limitation any appeal or petition for review thereof) against the Town or its agents, officers or employees related to an approval of the Project, including without limitation any related application, permit, certification, condition, environmental determination, other approval, compliance or failure to comply with applicable laws and regulations, and/or processing methods (“Challenge”). Town may (but is not obligated to) defend such Challenge as Town, in its sole discretion, determines appropriate, all at applicant’s sole cost and expense. Applicant shall bear any and all losses, damages, injuries, liabilities, costs and expenses (including, without limitation, staff time and in-house attorney’s fees on a fully-loaded basis, attorney’s fees for outside legal counsel, expert witness fees, court costs, and other litigation expenses) arising out of or related to any Challenge (“Costs”), whether incurred by Applicant, Town, or awarded to any third party, and shall pay to the Town upon demand any Costs incurred by the Town. No modification of the Project, any application, permit certification, condition, environmental determination, other approval, change in applicable laws and regulations, or change in such Challenge as Town, in its sole discretion, determines appropriate, all the applicant’s sole cost and expense. No modification of the Project, any application, permit certification, condition, environmental determination, other approval, change in applicable laws and regulations, or change in processing methods shall alter the applicant’s indemnity obligation. 21. COMPLIANCE MEMORANDUM: A memorandum shall be prepared and submitted with the building plans detailing how the Conditions of Approval will be addressed. Building Division 22. PERMITS REQUIRED: A Building Permit is required to construct the new comfort station. 23. APPLICABLE CODES: The current codes, as amended and adopted by the Town of Los Gatos as of January 1, 2023, are the 2022 California Building Standards Code, California Code of Regulations Title 24, Parts 1-12, including locally adopted Energy Reach Codes. 24. CONDITIONS OF APPROVAL: The Conditions of Approval must be included on plan sheets within the construction plans. A Compliance Memorandum detailing how the conditions of approval will be addressed shall be prepared and submitted with the building permit application. 25. SIZE OF PLANS: Minimum size 24” x 36”, maximum size 30” x 42”. 26. SOILS REPORT: A Soils Report, prepared to the satisfaction of the Building Official, Page 277 containing foundation, and retaining wall design recommendations, shall be submitted with the Building Permit Application. This report shall be prepared by a licensed Civil Engineer specializing in soil mechanics. 27. FOUNDATION INSPECTIONS: A pad certificate prepared by a licensed civil engineer or land surveyor shall be submitted to the project Building Inspector at the foundation inspection. This certificate shall certify compliance with the recommendations specified in the Soils Report, and that the building pad elevations and on-site retaining wall locations and elevations have been prepared according to the approved plans. Horizontal and vertical controls shall be set and certified by a licensed surveyor or registered Civil Engineer for the following items: a. Building pad elevation b. Finish floor elevation c. Foundation corner locations d. Retaining wall(s) locations and elevations 28. BACKWATER VALVE: As required by Town Ordinance 6.40.020, provide details for any required sanitary sewer backwater valve on the plans and provide its location. The Town of Los Gatos Ordinance and West Valley Sanitation District (WVSD) require backwater valves on drainage piping serving fixtures with flood level rims less than 12 inches above the elevation of the next upstream manhole. 29. HAZARDOUS FIRE ZONE: All Town of Los Gatos projects require Class A roof assemblies. 30. SPECIAL INSPECTIONS: When a special inspection is required by CBC Section 1704, the Architect or Engineer of Record shall prepare an inspection program that shall be submitted to the Building Official for approval prior to the issuance of the Building Permit. The Town Special Inspection form must be completely filled out and signed by all requested parties prior to permit issuance. Special Inspection forms are available online at www.losgatosca.gov/building. 31. CONSTRUCTION BEST MANAGEMENT PRACTICES (BMPs): The Town standard West Valley Clean Water Authority Nonpoint Source Pollution Control Program Sheet (page size same as submitted drawings) shall be part of the plan submittal. The specification sheet is available online at www.losgatosca.gov/building. 32. APPROVALS REQUIRED: The project requires the following departments and agencies' approval before issuing a building permit: a. Community Development – Planning Division: (408) 354-6874 b. Engineering/Parks & Public Works Department: (408) 399-5771 c. Santa Clara County Fire Department: (408) 378-4010 d. West Valley Sanitation District: (408) 378-2407 Page 278 TO THE SATISFACTION OF THE DIRECTOR OF PARKS AND PUBLIC WORKS: Engineering Division 33. GENERAL: All public improvements shall be made according to the latest adopted Town Standard Plans, Standard Specifications and Engineering Design Standards. All work shall conform to the applicable Town ordinances. The adjacent public right-of-way shall be kept clear of all job-related mud, silt, concrete, dirt and other construction debris at the end of the day. Dirt and debris shall not be washed into storm drainage facilities. The storing of goods and materials on the sidewalk and/or the street will not be allowed unless an encroachment permit is issued by the Engineering Division of the Parks and Public Works Department. The Owner’s representative in charge shall be at the job site during all working hours. Failure to maintain the public right-of-way according to this condition may result in the issuance of correction notices, citations, or stop work orders and the Town performing the required maintenance at the Owner’s expense. 34. PAYMENT OPTIONS: a. All payments regarding fees and deposits can be mailed to: Town of Los Gatos PPW – Attn: Engineering Dept 41 Miles Avenue Los Gatos, CA 95030 Or hand deliver/drop off payment in engineering lock box Checks made out to “Town of Los Gatos” and should mention address and application number on memo/note line. 35. APPROVAL: This application shall be completed in accordance with all the conditions of approval listed below and in substantial compliance with the latest reviewed and approved development plans. Any changes or modifications to the approved plans or conditions of approval shall be approved by the Town Engineer. 36. CONSTRUCTION PLAN REQUIREMENTS: Construction drawings shall comply with Section 1 (Construction Plan Requirements) of the Town’s Engineering Design Standards, which are available for download from the Town’s website. 37. CHANGE OF OCCUPANCY: Prior to initial occupancy and any subsequent change in use or occupancy of any non-residential condominium space, the buyer or the new or existing occupant shall apply to the Community Development Department and obtain approval for use determination and building permit and obtain inspection approval for any necessary work to establish the use and/or occupancy consistent with that intended. 38. GENERAL LIABILITY INSURANCE: The property owner shall provide proof of insurance to the Town on a yearly basis. In addition to general coverage, the policy must cover all elements encroaching into the Town’s right-of-way. 39. PUBLIC WORKS INSPECTIONS: The Owner, Applicant and/or Developer or their representative shall notify the Engineering Inspector at least twenty-four (24) hours before starting any work pertaining to on-site drainage facilities, grading or paving, and all work in the Town's right-of-way. Failure to do so will result in penalties and rejection of any work that occurred without inspection. Page 279 40. FENCES: Any fencing proposed within two hundred (200) feet of an intersection shall comply with Town Code Section §23.10.080. Fences between all adjacent parcels will need to be located on the property lines/boundary lines. Any existing fences that encroach into the neighbor’s property need to be removed and/or relocated along boundary lines before a Certificate of Occupancy for any new building can be issued. Waivers of this condition will require signed and notarized letters from all affected neighbors 41. RESTORATION OF PUBLIC IMPROVEMENTS: The Owner, Applicant and/or Developer or their representative shall repair or replace all existing improvements not designated for removal that are damaged or removed because of the Owner, Applicant and/or Developer or their representative's operations. Improvements such as, but not limited to curbs, gutters, sidewalks, driveways, signs, pavements, raised pavement markers, thermoplastic pavement markings, etc., shall be repaired and replaced to a condition equal to or better than the original condition. Any new concrete shall be free of stamps, logos, names, graffiti, etc. Any concrete identified that is displaying a stamp or equal shall be removed and replaced at the Contractor’s sole expense and no additional compensation shall be allowed, therefore. Existing improvement to be repaired or replaced shall be at the direction of the Engineering Construction Inspector and shall comply with all Title 24 Disabled Access provisions. The restoration of all improvements identified by the Engineering Construction Inspector shall be completed before the issuance of a certificate of occupancy. The Owner, Applicant and/or Developer or their representative shall request a walk-through with the Engineering Construction Inspector before the start of construction to verify existing conditions. 42. PLAN CHECK FEES: Plan check fees associated with the Grading Permit shall be deposited with the Engineering Division of the Parks and Public Works Department prior to the commencement of plan check review. 43. SITE SUPERVISION: The General Contractor shall always provide qualified supervision on the job site during construction. 44. INSPECTION FEES: Inspection fees shall be deposited with the Town prior to the issuance of permits or recordation of maps. 45. DESIGN CHANGES: Any proposed changes to the approved plans shall be subject to the approval of the Town prior to the commencement of all altered work. The Owner’s project engineer shall notify, in writing, the Town Engineer at least seventy-two (72) hours in advance of all the proposed changes. Any approved changes shall be incorporated into the final “as-built” plans. 46. PLANS AND STUDIES: All required plans and studies shall be prepared by a Registered Professional Engineer in the State of California and submitted to the Town Engineer for review and approval. Additionally, any post-project traffic or parking counts, or other studies imposed by the Planning Commission or Town Council shall be funded by the Owner, Applicant and/or Developer. 47. GRADING PERMIT DETERMINATION DURING CONSTRUCTION DRAWINGS: All grading work taking place with this application and related applications/projects within a two- year period are considered eligible for the grading permit process and will be counted toward the quantities used in determining grading permit requirements. In the event that, during the production of construction drawings and/or during construction of the Page 280 plans approved with this application by the Town of Los Gatos, it is determined that a grading permit would be required as described in Chapter 12, Article II (Grading Permit) of the Town Code of the Town of Los Gatos, an Architecture and Site Application would need to be submitted by the Owner for review and approval by the Development Review Committee prior to applying for a grading permit. 48. GRADING: Any grading work, cut/fill, earthwork or combination thereof (completed or proposed on submitted plans) on the parcel over the upcoming two-year period are combined with regards to grading permit thresholds. This also applies to adjacent parcels with identical owners, applicants and or developers. 49. ILLEGAL GRADING: Per the Town’s Comprehensive Fee Schedule, applications for work unlawfully completed shall be charged double the grading permit fee. As a result, the required grading permit fees associated with an application for grading will be charged accordingly. 50. DUST CONTROL: Blowing dust shall be reduced by timing construction activities so that paving and building construction begin as soon as possible after completion of grading, and by landscaping disturbed soil as soon as possible. Further, water trucks shall be present and in use at the construction site. All portions of the site subject to blowing dust shall be watered as often as deemed necessary by the Town, or a minimum of three (3) times daily, or apply (non-toxic) soil stabilizers on all unpaved access roads, parking areas, and staging areas at construction sites in order to insure proper control of blowing dust for the duration of the project. Watering on public streets shall not occur. Streets shall be cleaned by street sweepers or by hand as often as deemed necessary by the Town Engineer, or at least once a day. Watering associated with on-site construction activity shall take place between the hours of 8 a.m. and 5 p.m. and shall include at least one (1) late-afternoon watering to minimize the effects of blowing dust. All public streets soiled or littered due to this construction activity, shall be cleaned and swept daily during the workweek to the satisfaction of the Town. Demolition or earthwork activities shall be halted when wind speeds (instantaneous gusts) exceed twenty (20) miles per hour (MPH). All trucks hauling soil, sand, or other loose debris shall be covered. For sites greater than four (4) acres in area: a. Enclose, cover, water twice daily or apply (non-toxic) soil binders to exposed stockpiles (dirt, sand, etc.). b. Limit traffic speeds on unpaved roads to fifteen (15) miles per hour. c. Install sandbags or other erosion control measures to prevent silt runoff to public roadways. d. Replant vegetation in disturbed areas as quickly as possible. e. Hydroseed or apply (non-toxic) soil stabilizers to inactive construction areas (previously graded areas inactive for ten days or more). 51. CONSTRUCTION ACTIVITIES: All construction shall conform to the latest requirements of the CASQA Stormwater Best Management Practices Handbooks for Construction Activities and New Development and Redevelopment, the Town's grading and erosion control ordinance, and other generally accepted engineering practices for erosion control as required by the Town Engineer when undertaking construction activities. 52. SILT AND MUD IN PUBLIC RIGHT-OF-WAY: It is the responsibility of Contractor and homeowner to make sure that all dirt tracked into the public right-of-way is cleaned up Page 281 daily. Mud, silt, concrete and other construction debris SHALL NOT be washed into the Town’s storm drains. 53. COVERED TRUCKS: All trucks transporting materials to and from the site shall be covered. 54. GOOD HOUSEKEEPING: Good housekeeping practices shall be observed at all times during construction. All construction shall be diligently supervised by a person or persons authorized to do so at all times during working hours. The Owner’s representative in charge shall be at the job site during all working hours. Failure to maintain the public right-of-way according to this condition may result in penalties and/or the Town performing the required maintenance at the Owner’s expense. 55. SITE DESIGN MEASURES: All projects shall incorporate at least one of the following measures: a. Protect sensitive areas and minimize changes to the natural topography. b. Minimize impervious surface areas. c. Direct roof downspouts to vegetated areas. d. Use porous or pervious pavement surfaces on the driveway, at a minimum. e. Use landscaping to treat stormwater. 56. CONSTRUCTION HOURS: All improvements and construction activities, including the delivery of construction materials, labors, heavy equipment, supplies, etc., shall be limited to the hours of 8:00 a.m. to 6:00 p.m., weekdays and 9:00 a.m. to 4:00 p.m. Saturdays. The Town may authorize, on a case-by-case basis, alternate construction hours. The Owner, Applicant and/or Developer shall provide written notice twenty-four (24) hours in advance of modified construction hours. Approval of this request is at discretion of the Town. 57. CONSTRUCTION NOISE: Between the hours of 8:00 a.m. to 6:00 p.m., weekdays and 9:00 a.m. to 4:00 p.m. Saturdays, construction, alteration or repair activities shall be allowed. No individual piece of equipment shall produce a noise level exceeding eighty- five (85) dBA at twenty-five (25) feet from the source. If the device is located within a structure on the property, the measurement shall be made at distances as close to twenty-five (25) feet from the device as possible. The noise level at any point outside of the property plane shall not exceed eighty-five (85) dBA. 58. DELAYED/DEFERRED REPORTS AND REVIEWS: TLGPPW strongly recommend that reports requiring a peer review be submitted and completed prior to committee approval/building permit stage. Note that these reviews may require a design change by the applicant and/or additional studies. Applicants who chose to defer assume risk that required changes may send project back to planning stage. 59. UNLAWFUL DISCHARGES: It is unlawful to discharge any wastewater, or cause hazardous domestic waste materials to be deposited in such a manner or location as to constitute a threatened discharge, into storm drains, gutters, creeks or the San Francisco Bay. Unlawful discharges to storm drains include, but are not limited to: discharges from toilets, sinks, industrial processes, cooling systems, boilers, fabric cleaning, equipment cleaning or vehicle cleaning. 60. GEOTECHNICAL/GEOLOGICAL RECOMMENDATIONS: The project shall incorporate the geotechnical/geological recommendations contained in the project’s design-level geotechnical/geological investigation as prepared by the Owner’s engineer(s), and any Page 282 subsequently required report or addendum. Subsequent reports or addendum are subject to peer review by the Town’s consultant and costs shall be borne by the Owner, Applicant and/or Developer. 61. HAULING OF SOIL: Hauling of soil on- or off-site shall not occur during the morning or evening peak periods (between 7:00 a.m. and 9:00 a.m. and between 4:00 p.m. and 6:00 p.m.), and at other times as specified by the Director of Parks and Public Works. Prior to the issuance of an encroachment, grading or building permit, the Developer or their representative shall work with the Town Building Department and Engineering Division Inspectors to devise a traffic control plan to ensure safe and efficient traffic flow under periods when soil is hauled on or off the project site. This may include, but is not limited to provisions for the Developer to place construction notification signs noting the dates and time of construction and hauling activities, or providing additional traffic control. Coordination with other significant projects in the area may also be required. Cover all trucks hauling soil, sand and other loose debris. 62. ON-SITE/OFF-SITE PARKING: Parking spaces shall be paved with a compacted base not less than four (4) inches thick, surfaced with asphaltic concrete or Portland cement concrete pavement or other surfacing (e.g.: permeable paving materials, interlocking pavers and ribbon strip driveways) approved by the Town Engineer. 63. WATER METER: Water meters currently in public right-of-way shall be relocated within the property in question, within 30” of the property line / the public right-of-way line. The Owner, Applicant and/or Developer shall repair and replace to existing Town standards any portion of concrete flatwork within said right-of-way that is damaged during this activity prior to issuance of a certificate of occupancy. 64. SANITARY SEWER CLEANOUT: Sanitary sewer cleanouts currently in public right-of-way shall be relocated within the property in question, within one (1) foot of the property line per West Valley Sanitation District Standard Drawing 3, or at a location specified by the Town. The Owner, Applicant and/or Developer shall repair and replace to existing Town standards any portion of concrete flatwork within said right-of-way that is damaged during this activity prior to issuance of a certificate of occupancy. 65. PRIVATE UTILITIES: Private utilities in town right of way is prohibited and should be located on parcel which it serves, unless otherwise allowed via easement. 66. PRECONSTRUCTION MEETING: Prior to issuance of any grading or building permits or the commencement of any site work, the general contractor shall: a. Along with the Owner, Applicant and/or Developer, setup a pre-construction meeting with Eric Christianson, Senior Public Works Inspector echristianson@losgatosca.gov (408) 354-6824 to discuss the project conditions of approval, working hours, site maintenance and other construction matters; b. Acknowledge in writing that they have read and understand the project conditions of approval and will make certain that all project sub-contractors have read and understand them as well prior to commencing any work, and that a copy of the project conditions of approval will be posted on-site at all times during construction. 67. CONSTRUCTION VEHICLE PARKING: No construction vehicles, trucks, equipment and worker vehicles shall be allowed to park on the portion of any public (Town) streets without written approval from the Town Engineer. 68. FOR PLANTERS: The Owner, Applicant and/or Developer shall apply for an Page 283 encroachment permit for the proposed planters within the public sidewalk and/or Town’s right-of-way. The Owner, Applicant and/or Developer shall work with Parks and Public Works Department staff to arrive at a mutually agreeable solution that addresses safety and aesthetic issues. If no solution is reached, the vegetative screening requirement shall be waived. A Private Improvements in the Public Right-of-Way (formerly Indemnity) Agreement will be required if planters are proposed to be located within the Town’s right-of-way. A copy of the recorded agreement shall be submitted to the Engineering Division of the Parks and Public Works Department prior to the issuance of any grading or building permits. 69. PRIVATE IMPROVEMENTS IN THE PUBLIC RIGHT-OF-WAY (INDEMNITY AGREEMENT): The property owner shall enter into an agreement with the Town for all existing and proposed private improvements within the Town’s right-of-way. The Owner shall be solely responsible for maintaining the improvements in a good and safe condition at all times and shall indemnify the Town of Los Gatos. The agreement must be completed and accepted by the Director of Parks and Public Works, and subsequently recorded by the Town Clerk at the Santa Clara County Office of the Clerk-Recorder, prior to the issuance of any grading or building permits. 70. STREET/SIDEWALK CLOSURE: Any proposed blockage or partial closure of the street and/or sidewalk requires an encroachment permit. Special provisions such as limitations on works hours, protective enclosures, or other means to facilitate public access in a safe manner may be required. 71. GRADING PERMIT REQUIRED: A grading permit is required for all site grading and drainage work except for exemptions listed in Section 12.20.015 of The Code of the Town of Los Gatos (Grading Ordinance). All grading work taking place with this application and related applications/projects within a two-year period are considered eligible for the grading permit process and will be counted toward the quantities used in determining grading permit requirements. After the preceding Architecture and Site Application has been approved by the respective deciding body and the appeal period has passed, the grading permit application with grading plans and associated required materials shall be submitted via email to the PPW engineer assigned to the A&S review. Permit fees (determined after initial submittal) are based on the values in the fee schedule in effect during the entitlement review, grading permit application submittal or approval, whichever is greater. Payment shall be sent to the Engineering Division of the Parks and Public Works Department located at 41 Miles Avenue. Unless specifically allowed by the Director of Parks and Public Works, the grading permit will be issued concurrently with the building permit. Prior to Engineering signing off and closing out on the issued grading permit, the Owner’s soils engineer shall verify, with a stamped and signed letter, that the grading activities were completed per plans and per the requirements as noted in the soils report. 72. TREE REMOVAL: Copies of all necessary tree removal permits shall be provided prior to the issuance of a building permit. An arborist report may be necessary. Please contact Tammy Robnett-Illges, Engineering Administrative Assistant trobnett- illges@losgatosca.gov (408) 399-5771 for more information. a. Retaining wall: top of wall elevations and locations. b. Toe and top of cut and fill slopes. Page 284 c. Public Service Easement (PSE): Ten (10) feet wide, next to the Street Name right-of- way. d. Ingress-egress, storm drainage and sanitary sewer easements, as required. e. Trail Easement: Ten (10) feet wide, as shown on the tentative map. f. Emergency Access Easement: Twenty (20) feet wide, from the end of the public road to location. 73. ADA COMPLIANCE: The Owner, Applicant and/or Developer shall be required to meet all ADA standards, which must be completed and accepted by the Town before a Certificate of Occupancy for any new building can be issued. This may require additional construction measures as directed by the Town. 74. PARKING LOTS: Parking lots and other impervious areas shall be designed to drain stormwater runoff to vegetated drainage swales, filter strips, and/or other Low Impact Development (LID) treatment devices that can be integrated into required landscaping areas and traffic islands prior to discharge into the storm drain system and/or public right-of-way. The amount of impervious area associated with parking lots shall be minimized by utilizing design features such as providing compact car spaces, reducing stall dimensions, incorporating efficient parking lanes, using permeable pavement where feasible, and adhering to the Town’s Parking Development Standards. The use of permeable paving for parking surfaces is encouraged to reduce runoff from the site. Such paving shall meet Santa Clara County Fire Department requirements and be structurally appropriate for the location. 75. UTILITIES: The Owner, Applicant and/or Developer shall install all new, relocated, or temporarily removed utility services, including telephone, electric power and all other communications lines underground, as required by Town Code Section 27.50.015(b). All new utility services shall be placed underground. Underground conduit shall be provided for cable television service. The Owner, Applicant and/or Developer is required to obtain approval of all proposed utility alignments from all utility service providers before a Certificate of Occupancy for any new building can be issued. The Town of Los Gatos does not approve or imply approval for final alignment or design of these facilities. 76. SIDEWALK REPAIR: The Owner, Applicant and/or Developer shall repair and replace to existing Town standards any sidewalk damaged now or during construction of this project. All new and existing adjacent infrastructure must meet current ADA standards. Sidewalk repair shall match existing color, texture and design, and shall be constructed per Town Standard Details. New concrete shall be free of stamps, logos, names, graffiti, etc. Any concrete identified that is displaying a stamp or equal shall be removed and replaced at the Contractor’s sole expense and no additional compensation shall be allowed therefore. The limits of sidewalk repair will be determined by the Engineering Construction Inspector during the construction phase of the project. The improvements must be completed and accepted by the Town before a Certificate of Occupancy for any new building can be issued. 77. CURB AND GUTTER REPAIR: The Owner, Applicant and/or Developer shall repair and replace to existing Town standards any curb and gutter damaged now or during construction of this project. All new and existing adjacent infrastructure must meet Town standards. New curb and gutter shall be constructed per Town Standard Details. Page 285 New concrete shall be free of stamps, logos, names, graffiti, etc. Any concrete identified that is displaying a stamp or equal shall be removed and replaced at the Contractor’s sole expense and no additional compensation shall be allowed therefore. The limits of curb and gutter repair will be determined by the Engineering Construction Inspector during the construction phase of the project. The improvements must be completed and accepted by the Town before a Certificate of Occupancy for any new building can be issued. 78. VALLEY GUTTER REPAIR: The Owner/Applicant shall repair and replace to existing Town standards any valley gutter damaged now or during construction of this project. All new and existing adjacent infrastructure must meet Town standards. New valley gutter shall be constructed per Town Standard Details. New concrete shall be free of stamps, logos, names, graffiti, etc. Any concrete identified that is displaying a stamp or equal shall be removed and replaced at the Contractor’s sole expense and no additional compensation shall be allowed therefore. The limits of valley gutter repair will be determined by the Engineering Construction Inspector during the construction phase of the project. The improvements must be completed and accepted by the Town before a Certificate of Occupancy for any new building can be issued. 79. CONSTRUCTION MANAGEMENT PLAN SHEET: Prior to the issuance of any grading or building permits, the Owner and/or Applicant’s design consultant shall submit a construction management plan sheet (full-size) within the plan set that shall incorporate at a minimum the Earth Movement Plan, Traffic Control Plan, Project Schedule, site security fencing, employee parking, construction staging area, materials storage area(s), construction trailer(s), concrete washout(s) and proposed outhouse locations. Please refer to the Town’s Construction Management Plan Guidelines document for additional information. 80. STORMWATER MANAGEMENT: Construction activities including but not limited to clearing, stockpiling, grading or excavation of land, which disturbs one (1) acre or more which are part of a larger common plan of development which disturbs less than one (1) acre are required to obtain coverage under the construction general permit with the State Water Resources Control Board. The Owner, Applicant and/or Developer is required to provide proof of WDID# and keep a current copy of the storm water pollution prevention plan (SWPPP) on the construction site and shall be made available to the Town of Los Gatos Engineering Division of the Parks and Public Works Department and/or Building Department upon request. 81. BEST MANAGEMENT PRACTICES (BMPs): The Owner, Applicant and/or Developer is responsible for ensuring that all contractors are aware of all storm water quality measures and that such measures are implemented. Best Management Practices (BMPs) shall be maintained and be placed for all areas that have been graded or disturbed and for all material, equipment and/or operations that need protection. Removal of BMPs (temporary removal during construction activities) shall be replaced at the end of each working day. Failure to comply with the construction BMP will result in the issuance of correction notices, citations, or stop work orders. 82. REGULATED PROJECT: The project is classified as a Regulated Project per Provision C.3.b.ii. and is required to implement LID source control, site design, and stormwater treatment on-site in accordance with Provisions C.3.c. and C.3.d. Page 286 83. NPDES STORMWATER COMPLIANCE: In the event that, during the production of construction drawings for the plans approved with this application by the Town of Los Gatos, it is determined that the project will create and/or replace more than 2,500 square feet of impervious area, completion of the NPDES Stormwater Compliance Small Projects Worksheet and implementation of at least one of the six low impact development site design measures it specifies shall be completed and submitted to the Engineering Division before issuance of a grading/building permit. 84. BIORETENTION SYSTEM: The bioretention system(s) shall be designed to have a surface area no smaller than what is required to accommodate a 5 inches/hour stormwater runoff surface loading rate, infiltrate runoff through bioretention soil media at a minimum of 5 inches per hour, and maximize infiltration to the native soil during the life of the project. The soil media for bioretention system(s) shall be designed to sustain healthy, vigorous plant growth and maximize stormwater runoff retention and pollutant removal. Bioretention soil media that meets the minimum specifications set forth in Attachment L of Order No. R2-2022-0018 shall be used. 85. INFILTRATION TRENCHES: The following requirements apply to the proposed infiltration trenches: a. Prior to completion of the Final Stormwater Control Plan, a geotechnical engineer shall review the design of the infiltration trenches and retaining walls along the portion of the road within the property boundary and determine whether additional structural supports are needed to ensure stability of the road and the adjacent hillside during the wet season. b. The assumed infiltration rate of 0.67 in/hour shall be verified with actual site-specific soils data prior to the Final Stormwater Control Plan for the road and development on each lot, and if the infiltration rate is lower than 0.67 in/hour, a hydrologic analysis shall be conducted to ensure that the proposed trench sizes are adequate. c. If the lots are to be developed individually, each lot shall provide infiltration trenches consistent with the final stormwater control plan for the project, sized based on the actual amount of impervious surface to be created on the lot. d. The road and infiltration trenches shall be protected from sediment generated during construction of homes on the lots. The proposed source control measures shall be indicated on the project plans. e. Maintenance of stormwater treatment and the infiltration trenches shall be the responsibility of the property owner and/or future property owners. A maintenance agreement shall be prepared establishing the property owner or owners’ responsibility. 86. LANDSCAPE MAINTENANCE AGREEMENT: The Developer shall enter into a Landscape Maintenance Agreement with the Town of Los Gatos in which the Developer agrees to maintain the vegetated areas along the project’s Wedgewood Avenue frontage located within the public right-of-way. The agreement must be completed and accepted by the Town Attorney prior to the issuance of any encroachment, grading or building permits. 87. EROSION CONTROL: Interim and final erosion control plans shall be prepared and submitted to the Engineering Division of the Parks and Public Works Department. A Notice of Intent (NOI) and Storm Water Pollution Prevention Plan (SWPPP) shall be submitted to the San Francisco Bay Regional Water Quality Control Board for projects Page 287 disturbing more than one (1) acre. A maximum of two (2) weeks is allowed between clearing of an area and stabilizing/building on an area if grading is allowed during the rainy season. Interim erosion control measures, to be carried out during construction and before installation of the final landscaping, shall be included. Interim erosion control method shall include, but are not limited to: silt fences, fiber rolls (with locations and details), erosion control blankets, Town standard seeding specification, filter berms, check dams, retention basins, etc. Provide erosion control measures as needed to protect downstream water quality during winter months. The grading, drainage, erosion control plans and SWPPP shall comply with applicable measures contained in the amended provisions C.3 and C.14 of most current Santa Clara County National Pollutant Discharge Elimination System (NPDES) Municipal Regional Permit (MRP). Monitoring for erosion and sediment control is required and shall be performed by the Qualified SWPPP Developer (QSD) or Qualified SWPPP Practitioner (QSP) as required by the Construction General Permit. Stormwater samples are required for all discharge locations and projects may not exceed limits set forth by the Construction General Permit Numeric Action Levels and/or Numeric Effluent Levels. A Rain Event Action Plan (REAP) must be developed forty-eight (48) hours prior to any likely precipitation even, defined by a fifty (50) percent or greater probability as determined by the National Oceanic and Atmospheric Administration (NOAA), and/or whenever rain is imminent. The QSD or QSP must print and save records of the precipitation forecast for the project location area from (http://www.srh.noaa.gov/forecast) which must accompany monitoring reports and sampling test data. A rain gauge is required on-site. The Town of Los Gatos Engineering Division of the Parks and Public Works Department and the Building Department will conduct periodic NPDES inspections of the site throughout the recognized storm season to verify compliance with the Construction General Permit and Stormwater ordinances and regulations. 88. AIR QUALITY: To limit the project’s construction-related dust and criteria pollutant emissions, the following the Bay Area Air Quality Management District (BAAQMD)- recommended basic construction measures shall be included in the project’s grading plan, building plans, and contract specifications: a. All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day, or otherwise kept dust- free. b. All haul trucks designated for removal of excavated soil and demolition debris from site shall be staged off-site until materials are ready for immediate loading and removal from site. c. All haul trucks transporting soil, sand, debris, or other loose material off-site shall be covered. d. As practicable, all haul trucks and other large construction equipment shall be staged in areas away from the adjacent residential homes. e. All visible mud or dirt track-out onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day, or as deemed appropriate by Town Engineer. The use of dry power sweeping is prohibited. An on-site track- out control device is also recommended to minimize mud and dirt-track-out onto adjacent public roads. Page 288 f. All vehicle speeds on unpaved surfaces shall be limited to fifteen (15) miles per hour. g. All driveways and sidewalks to be paved shall be completed as soon as possible. Building pads shall be laid as soon as possible after grading unless seeding or soil binders are used. h. Post a publicly visible sign with the telephone number and person to contact at the lead agency regarding dust complaints. This person shall respond and take corrective action within forty-eight (48) hours. The Air District’s phone number shall also be visible to ensure compliance with applicable regulations. Please provide the BAAQMD’s complaint number on the sign: 24-hour toll-free hotline at 1-800-334- ODOR (6367). i. All excavation, grading, and/or demolition activities shall be suspended when average wind speeds exceed twenty (20) miles per hour. j. Vegetative ground cover (e.g., fast-germinating native grass seed) shall be planted in disturbed areas as soon as possible and watered appropriately until vegetation is established. 89. SITE DRAINAGE: Rainwater leaders shall be discharged to splash blocks. No through curb drains will be allowed. Any storm drain inlets (public or private) directly connected to public storm system shall be stenciled/signed with appropriate “NO DUMPING - Flows to Bay” NPDES required language. On-site drainage systems for all projects shall include one of the alternatives included in section C.3.i of the Municipal Regional NPDES Permit. These include storm water reuse via cisterns or rain barrels, directing runoff from impervious surfaces to vegetated areas and use of permeable surfaces. If stormwater treatment facilities are to be used they shall be placed a minimum of ten (10) feet from the adjacent property line and/or right-of-way. Alternatively, the facility(ies) may be located with an offset between 5 and 10 feet from the adjacent property and/or right- of-way line(s) if the responsible engineer in charge provides a stamped and signed letter that addresses infiltration and states how facilities, improvements and infrastructure within the Town’s right-of-way (driveway approach, curb and gutter, etc.) and/or the adjacent property will not be adversely affected. No improvements shall obstruct or divert runoff to the detriment of an adjacent, downstream or down slope property. 90. OFF-SITE DRAINAGE: The Owner, Applicant and/or Developer shall construct and install a private on-site storm drain system that is adequately sized to collect and convey adjacent off-site tributary drainage. Hydraulic calculations for a 100-year storm event shall provide documentation that the proposed storm drain system can convey said off- site drainage as well as on-site drainage during this event over, within, through and off the site, and ultimately into the Town’s storm drain system. 91. STORM WATER MANAGEMENT PLAN: A storm water management plan shall be included with the grading permit application for all Group 1 and Group 2 projects as defined in the amended provisions C.3 of the Municipal Regional Stormwater NPDES Permit, Order R2-2022-0018, NPDES Permit No. CAS612008. The plan shall delineate source control measures and BMPs together with the sizing calculations. The plan shall be certified by a professional pre-qualified by the Town. If the storm water measures proposed on the Planning approval differ significantly from those certified on the Building/Grading Permit, the Town may require a modification of the Planning approval prior to release of the Building Permit. The Owner, Applicant and/or Developer may Page 289 elect to have the Planning submittal certified to avoid this possibility. 92. STORM WATER MANAGEMENT PLAN NOTES: The following note shall be added to the storm water management plan: “The biotreatment soil mix used in all stormwater treatment landscapes shall comply with the specifications in Attachment L of the MRP. Proof of compliance shall be submitted by the Contractor to the Town of Los Gatos a minimum of thirty (30) days prior to delivery of the material to the job site using the Biotreatment Soil Mix Supplier Certification Statement.” 93. STORM WATER MANAGEMENT PLAN CERTIFICATION: Certification from the biotreatment soils provider is required and shall be given to Engineering Division Inspection staff a minimum of thirty (30) days prior to delivery of the material to the job site. Additionally deliver tags from the soil mix shall also be provided to Engineering Division Inspection staff. Sample Certification can be found here: http://www.scvurppp-w2k.com/nd_wp.shtml?zoom_highlight=BIOTREATMENT+SOIL. 94. AGREEMENT FOR STORMWATER BEST MANAGEMENT PRACTICES INSPECTION AND MAINTENANCE OBLIGATIONS: The property owner/homeowner’s association shall enter into an agreement with the Town for maintenance of the stormwater filtration devices required to be installed on this project by the Town’s Stormwater Discharge Permit and all current amendments or modifications. The agreement shall specify that certain routine maintenance shall be performed by the property owner/homeowner’s association and shall specify device maintenance reporting requirements. The agreement shall also specify routine inspection requirements, permits and payment of fees. The agreement shall be recorded, and an electronic copy (PDF) of the recorded agreement shall be submitted to the Engineering Division of the Parks and Public Works Department, prior to the release of any occupancy permits. TO THE SATISFACTION OF THE SANTA CLARA COUNTY FIRE DEPARTMENT: 95. GENERAL: Review of this Developmental proposal is limited to acceptability of site access, water supply and may include specific additional requirements as they pertain to fire department operations, and shall not be construed as a substitute for formal plan review to determine compliance with adopted model codes. Prior to performing any work, the applicant shall make application to, and receive from, the Building Department all applicable construction permits. 96. FIRE APPARATUS (ENGINE)ACCESS ROADWAY REQUIRED: (As Noted on Sheet C6.0) Provide an access roadway with a paved all-weather surface, a minimum unobstructed width of 20 feet, vertical clearance of 13 feet 6 inches, minimum circulating turning radius of 50 feet outside and 30 feet inside, and a maximum slope of 15%. Installations shall conform to Fire Department Standard Details and Specifications sheet A-1. CFC Sec. 503. 97. FIRE LANES REQUIRED: (As Noted on Sheet C-6.0) The minimum clear width of fire department access roads shall be 20 feet. Fire apparatus access roads shall be designated and marked as a fire lane as set forth in Section 22500.1 of the California Vehicle Code. 98. FIRE HYDRANT SYSTEMS REQUIRED: (Hydrant relocation shown on sheet C6.0) Where a portion of the facility or building hereafter constructed or moved into or within the jurisdiction is more than 400 feet from a hydrant on a fire apparatus access road, as Page 290 measured by an approved route around the exterior of the facility or building, onsite fire hydrants and mains shall be provided where required by the fire code official. Exception: For Group R-3 and Group U occupancies, equipped throughout with an approved automatic sprinkler system installed in accordance with Section 903.3.1.1, 903.3.1.2 or 903.3.1.3, the distance requirement shall be not more than 600 feet. [CFC, Section 507.5.1] On the building permit coversheet, make a note that hydrant relocation as a deferral submittal. 99. EMERGENCY GATE/ACCESS GATE REQUIREMENTS: (Knox switch for existing gate shown on sheet C6.0) Gate installations shall conform with Fire Department Standard Details and Specification G-1 and, when open shall not obstruct any portion of the required width of 20' for emergency access roadways or driveways. Locks, if provided, shall be fire department approved prior to installation. Gates across the emergency access roadways shall be equipped with an approved access device. If the gates are operated electrically, an approved Knox key switch shall be installed; if they are operated manually, then an approved Knox padlock shall be installed. S:\PLANNING COMMISSION REPORTS\2025\08-13-2025\Item X - La Rinconada Golf Course\Exhibit 3 - Recommended Conditions of Approval.docx Page 291 This Page Intentionally Left Blank Page 292 .. "' ...... CONDITIONS OF APPROVAL May 11, 2011 14595 Clearview Drive Conditional Use Permit U-11-002 Requesting approval to increase the allowed membership for the La Rinconada Country Club on property zoned RC, R-1:12, and R-1:20. APNS 409-31-001,409-18- 007 and 409-29-018 PROPERTY OWNER: MaxineNevine APPLICANT: La Rinconada Country Club TO THE SATISFACTION OF THE DIRECTOR OF COMMUNITY DEVELOPMENT: (Planning Division) 1. USE. Uses permitted include a private golf course with driving range, clubhouse, pool, and fitness facilities. The pool and fitness facilities are to be used by members and their guests only. . 2. HOURS OF OPERATION. Hours of operation for Club room facilities shall be limited from 7 a.m. to 1 a.m. daily. The maximum operating hours of the pool and fitness facilities is between 6 a.m. to 10 p.m. daily. 3. MEMBERSHIP. A total of 446 "certified" members, and 125 "other" members, are permitted. The maximum number of certified and social members combined shall not exceed 571. 4. COMMUNITY BENEFIT FUNDS. The applicant has offered to provide the Town of Los Gatos rights and access to install the necessary water lines and equipment to provide irrigation to the public Right of Way along Wedgewood A venue. In addition the applicant has offered to provide the water for the landscaping improvements for a period of two years from the completion of installation. 5. TRAFFIC IMPACT MITIGATION FEE. The developer shall pay a fee proportional to the project's share of transportation improvement needed to serve cumulative development within the Town of Los Gatos. The fee amount will be based upon the Town Council resolution in effect at the time the building permit application is made. The fee shall be paid before the building permit is issued. The traffic impact mitigation fee for this project, using the current fee schedule and the preliminary plans is $6,420.00. The final fee shall be calculated from the final plans using the rate schedule in effect at the time of the building permit application, using a trip generation rate based on the application for additional 50 members. 6. SEA TS. The maximum number of inside and outside seats in the dining area shall not exceed 252. The maximum number of inside and outside seats in the grill room and snack shack area shall not exceed a total of 68. 7. OUTSIDE DINING. Patio meal service shall cease at 10 p.m. 8. MUSIC. Music is permitted inside the club house and fitness buildings. There shall be no outdoor music. 9. SERVICE VEHICLES. All service trucks and vendors shall only use the Wedgewood A venue entrance and exit. The applicant shall request that vendor EXHIBIT 4Page 293 r n deliveries occur between 9 a.m. and 3 p.m. No staging of delivery trucks shall occur on Town streets. 10. SECURITY GUARDS. A uniformed security guard shall be present at all large party functions. 11. SIGNS. Sign shall be posted at exit from parking lot reminding drivers to exercise caution as they're going through a residential area with poor visibility in some areas. 12. CLUB POLICY. The management of the Club shall maintain a policy to inform club members on how to use the driving range to reduce errant golf balls. 13. MEMBERSHIP NOTICE. The letter to the membership and the Country Club's web site shall continue to include a reminder on how to use the driving range. 14. ANNUAL MEETINGS. The management of the Club shall hold annual meetings with their neighbors on Clearview Drive and Wedgewood Avenue to discuss 15. 16. 17. 18. 19. 20. issues or concerns. POLICING DRIVING RANGE. The driving range shall be policed by its members or staff at all times when in use to ensure the range is being used correctly. An employee shaH 'be .ph,ysicaHy. p17es.ent:atithe range_ Jo obs~rve.~and: ~:.' · : monitor all of the activities during the peak periods of errant golf balls on the days and hours stated in their letter, dated January 4, 2005, Exhibit B, of the report to the Planning Commission dated May 16, 2005. These days and hours may be modified if requested in writing by the La Rinconada Country Club and approved by Community Development Department. GOLF SIGNAGE. Signs shall be placed on all the ball machines to inform golfers to direct their golf shots towards the center of the driving range. Signage shall be maintained on the range reminding golfers to hit towards the center of the range and/or the targets. DRIVING RANGE. The direction of the first four stalls on the left side of the driving shall be maintained toward the center of the driving range INSPECTION. Country Club staff shall inspect along Wedgewood Avenue once a week for errant golf balls and document their findings .. HITTING STALLS. The four .stalls c1osestto Wedgewood Avenue·shall probibit the use of irons above seven. The stalls closest to Wedgewood A venue shall be available for right handed golfers only. NOTICE TO NEIGHBORS. The applicant shall notify impacted neighbors the dates and times of proposed sand deliveries. N:\DEV\CONDITNS\2011\14595 Clearview.doc Page 294 1 July 1, 2025 Joel Paulson, Director Community Development Department Town of Los Gatos 110 E. Main Street Los Gatos, CA 95030 RE: La Rinconada Country Club - Golf Course Modernization Project Architectural & Site Review, Grading & Tree Removal Permit Applications Project Description & Letter of Justification (3rd UPDATE) Dear Mr. Paulson, On behalf of La Rinconada Country Club, I am writing to provide you and the Town of Los Gatos with updated background information about our golf course modernization project and supporting justifications for approval of the applications noted above. As you know, we submitted initial applications to the Town on January 17th, resubmitted updated plans on April 9th and May 23rd, and are now submitting what we anticipate are final plans and supporting documents to undertake a full modernization of the golf course to make it more environmentally sustainable, responsible, and enjoyable for future generations. La Rinconada Golf Course History Founded almost 100 years ago in 1929, La Rinconada is one of the most beautiful properties in the Santa Clara Valley. The Club overlooks the valley from the western foothills to the Santa Cruz Mountains. Members enjoy a beautiful 18-hole golf course amid the local scenery with views across Silicon Valley. In addition to golf, we offer junior golf programs, swimming, fitness, bocce ball, yoga, dining and several social events to our members and the Los Gatos community. Our Club consists of 517 members, more than 250 of whom are Town residents, many for decades. The organization acquired fee title ownership of all the land in 2021 to ensure its continuation as a golf course and asset to the community in perpetuity. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. The clubhouse regularly plays host to a wide variety of community serving events including many charitable activities such as the Dave’s Avenue School Auction, Los Gatos New Millennium Foundation, Los Gatos Community Foundation, Hope Services, and Los Gatos High School Athletic Hall of Fame Induction. EXHIBIT 5Page 295 2 Property Overview The 118.4 acre property and surrounding area was originally grasslands, then farmland and orchards, without many trees when the Club was originally established. It now includes an 18- hole golf course, driving range, practice greens, maintenance facility, a clubhouse with dining room and event space, a pool and fitness facility, and on-site parking. The property is primarily surrounded by single family homes on larger lots that were built over decades around the golf course, and many of our neighbors are members of the Club as well. We maintain more than 1,200 trees most of which the Club planted beginning in the 1950’s. Over several decades hundreds of trees were added to the site to facilitate course operations. Most of the trees were placed around the perimeter of the course and surrounding play corridors to support the current course layout without consideration for potential challenges their growth over many decades might create. Golf Course Modernization Goals While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course has not been comprehensively modernized to ensure long term sustainability or improved playability since the early 1990s. Golf courses typically require major rehabilitation after a 30 year period because fairways grasses become compromised and irrigation and drainage, especially around greens and bunkers, begin to fail. Many other courses in the region have gone through similar renovations recently including the Sharon Heights Golf Club in Menlo Park, Palo Alto Hills Country Club in Palo Alto, Palo Alto Municipal Golf Course, Lake Merced Golf Club in Daly City, The Olympic Club in San Francisco, and Pruneridge Golf Club in Santa Clara has announced similar future plans. The Club now desires to modernize the golf course to make it more environmentally sustainable, safer and more fire resistant, improve course quality and playability for the enjoyment of future generations and ensure long term financial viability of the course. One of our primary goals is to continue to dramatically reduce water usage. The additions of new wells, reduction of irrigated turf, and the refurbishment of retention ponds on the course over the last twenty years reduced water consumption by 30% over historic use. However, a full course redesign is required to make further significant progress. Project Description After years of course planning and coordination, our Club’s plan (which has been overwhelming approved and is being paid for by our members) is to completely modernize the 18-hole layout and replant the entire course by replacing fairways with more drought tolerant Bermuda grasses, adding native drought tolerant and climate responsive trees and plantings and installing a more efficient irrigation system that will reduce our water usage by an additional 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the site. We have undertaken a classic renovation aligning with the Golden Age of Golf Course Architecture including a new course alignment for a few holes, refinement of fairway contours on Page 296 3 the other corridors, and new bunkers and greens across the entire course. The golf course modernization project will include modest grading while remaining neutral on site with material, tree removal, new drainage and irrigation, updated contouring, new bunkers and greens, new cart paths, realignment of the entry drive, a native tree replanting program, updated fairways and greens, a 250 square foot restroom/comfort station and other associated course landscaping. Town Development Review Process The golf course property has a General Plan Land Use designation of “Open Space” and Zoning District Designations of “Resource Conservation and R-1:20.” The Club operates under a Conditional Use Permit dated May 11th, 2011 that allows all of the ongoing uses on the property that exist today. Our understanding is that the limited site work we intend to undertake requires Architectural & Site Review, a Grading Permit and Tree Removal Permit to be issued by the Town. There are no changes proposed to the Conditional Use Permit. The Club reviewed the CUP and its conditions of approval prior to submission of the original applications to confirm its ability to continue to comply with all of them through the completion of the proposed project. We want to highlight a few key points for each of applications: Architectural & Site Review (Permit No. S25-005) Minimal above grade work is planned other than a slight realignment of the entrance drive to improve safety with golf play and a small restroom facility for the back 9 holes. No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. Conceptual Grading and Future Grading Permit While grading will occur over the entire course to create a new layout and contouring, no deep cut and fill areas or retaining walls are required. Most importantly, grading will balance on site so no major import or export of soil is required to complete the project and will minimize truck hauling. The revised application submittal actually reduces grading by more than 10% from the original plan submitted for review. Construction equipment and materials will be staged on site and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. The staging area will be near the current 5th hole across the parking lot to the west of the pool and is identified on the revised plan set. Tree Removal Permit (Permit No. T25-013) A critical element of the course modernization project is to reduce water usage by planting new drought tolerant grass and native trees through a reforestation program that are better equipped to thrive in our climate zone over many decades. Many of the trees added to the site over the past 60 years are non-natives that were originally planted to improve playability on the golf course by separating fairways but now hinder the long term success of the course by requiring excessive watering and creating over-shading that prevents grass from growing where play occurs. Over the last few years more than 100 trees have fallen on the course after storms or Page 297 4 failed as a result of drought despite the Club’s considerable efforts to maintain them. Many of the trees, especially the coast redwoods, can only be maintained through extensive watering, which can no longer be supported. The Club’s expectation based on past experience is that most of these non-native trees cannot survive over the long term once regular watering is eliminated as they are not drought-tolerant and will create increasing safety challenges as time goes on. Equally important, the new drought tolerant grass requires more sunlight to grow and many non- native trees are in locations that will prevent new grasses from growing successfully due to narrow fairways, tree heights and excessive shading. The Club currently maintains over 1,200 mature trees across its property. In order to achieve our water reduction goals and course layout plan and address tree health and safety issues, we need to remove a significant number of trees, primarily non-native eucalyptus and coast redwoods which are not drought tolerant, that were planted in the 1950s and beyond. This approach to sustainability is not unique to the Club as similar golf course updates in the region noted earlier and dozens across the state and county have taken similar steps, many with much more significant tree removal included in their modernization efforts. The Club has worked closely with a well-respected, local certified arborist, Trees 360 Degrees, to create a thoughtful and responsible tree protection, disposition and planting plan for the modernization project. The plan will retain and enhance the neighborhood character and the Town’s urban forest by planting more native, drought tolerant and climate responsive trees and avoiding further tree loss. Please see the updated Architectural & Site Review application plan set dated July 1st for more detailed information about the tree inventory and tree protection, disposition and replanting plan we are proposing. The Club had proposed removing 240 mature trees, mostly non-natives, to support its modernization and sustainability goals. In addition the project arborist has identified 47 additional trees that pose potential hazards and recommends their removal as part of the project, and the Town’s consulting arborist has concurred with this assessment. The final number of trees proposed for removal is 287. However, we have a reforestation plan that includes replanting 173 native trees, primarily mature oaks in 24-60 inch boxes that significantly exceed Town size requirements, and we will also pay significant in-lieu fees to support the Town’s urban reforestation program elsewhere in the community. The net result will leave the property with approximately 1,100 trees when the project is complete; however, trees on site will be more sustainable in future and be located in more thoughtful locations that will enable a successful transition to water saving Bermuda grass and an improved course layout. A revised and updated final arborist’s report dated July 1st which addresses all Town staff’s prior comments and the Town’s consulting arborist peer review input is being filed with the updated project plan set. We are also including a separate more detailed explanation of the reasons for the tree removal and replanting plan attached as Exhibit 1. The Club is proposing a unique plan to both replant 173 trees, many of which are larger than required under the City’s tree replacement program, and pay in lieu fees which will likely exceed $75,000 once finally Page 298 5 calculated by Town staff. Exhibit 1 includes a more detailed description of the replanting plan and in lieu fee calculation to credit large box trees for which the current Town formula does not account. It also includes a request for modification and augmentation of the Town’s typical tree fencing materials for developed parcels which do not work effectively on large open space projects like the golf course. The applicant seeks approval for both the updated in lieu fee formula and tree protection plan as part of the A&S and Tree Removal Permit application. CEQA The Club has engaged David J. Powers & Associates, Inc., a well-respected local environmental planning firm, to characterize the project and review it under guidelines established by California Environmental Quality Act and Town to facilitate the Planning Department’s independent CEQA compliance assessment. The study includes separate assessments for site biology, noise and vibration, construction emissions and health risk. The environmental assessment, submitted to the Planning Department in mid-April, concludes that the project qualifies for a categorical exemption for further study under CEQA. Neighborhood Compatibility La Rinconada has operated for decades at its current location in harmony with the neighborhood that has grown up around the course. As we do not plan any expansion of facilities or operations, only a modernization of the golf course, this project will not change the experience our neighbors have with the day to day course operations in any way. Community Benefits As noted above, one of the primary Club goals is to further enhance the environmental sustainability of the golf course. This modernization facilitates the reduction of water usage by 30-40%, saving approximately 30 million gallons annually. It will also allow the Club to be more competitive and financially sustainable over the long term, ensuring preservation of one of the Town’s largest open spaces for generations to come. The project helps maintain the neighborhood’s character and will enhance the Town’s urban forest with a reforestation program focused on planting large box mature native trees. The tree removal plan will also improve course safety and fire safety by removing more hazardous non-native eucalyptus trees. Timeline The Club anticipates the entire project will require the course to be closed for approximately 12- 14 months with a 7-8 month construction schedule and 5-6 month grass grow-in period. The clubhouse and pool and fitness center will remain open during the course construction period. We plan to commence construction in March, 2026 and progress sequentially from hole to hole so only portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, modernization activity will last approximately two to four weeks per hole, depending on the specific hole’s design and level of work. Page 299 6 While earth moving activities will occur on the interior of the property, typical construction noise that comes with large structures is not part of the project. As noted above, only the short realignment of the entry drive and the small comfort station on the interior course are being built. Community Outreach The Club has worked cooperatively with the community for years to ensure the golf course remains an asset to the community, and we maintain close and cordial relations with neighbors, many of whom are members. As but one example, the Club just recently partnered with the local neighborhood in coordination with the Los Gatos Police Department and Flock Safety on a neighborhood watch program. We have undertaken an extensive community outreach program with our immediate and nearby neighbors and larger community about the course modernization project. We started by adding an information page to the club’s web site about proposed project and it is also listed on the Town’s current projects web page. Numerous media stories have also covered the proposed modernization efforts. We started neighborhood outreach meetings with one-on-one meetings at the beginning of the year and followed this with neighborhood Open Houses at the Club to discuss the project and address any questions or concerns. We hand-delivered an introductory letter to 83 fence-line neighbors at the same time the original application was filed on January 24th. In March, the Club also invited the entire neighborhood to a series of six (6) small group Open House events. We used the Town provided mailing list of properties within 300 foot radius including over 350 occupant records and mailed invitations to each household via US Mail. In addition to mailing Open House invitations to neighbors within the 300 foot radius, we also sent Open House invitations to 500 additional nearby households via US Mail including Winchester Boulevard, Clearview Drive, Golf Links Drive, Clara Street, Eaton Lane, Zena, La Rinconada Drive, Wimbledon Drive, Newell Ave., Smith Ranch Court, and other streets in the broader neighborhood. Also included in each letter was a link to the Club’s website that includes a dedicated webpage with information about the project. (Copies of these seven (7) neighborhood outreach letters are attached as Exhibit 2.) The Open Houses were held on the following dates: • March 20, 2025, 5-7 PM • March 22, 2025, 12-2 PM • March 25, 2025, 5-7 PM • April 8, 2025, 5-7 PM • April 10, 2025, 5-7 PM • April 12, 20205, 5-7 PM Club leadership met with nearly 50 people as a result of this formal outreach process in addition to many others through day-to-day club operations and interactions with neighbors. A more Page 300 7 detailed summary of our outreach efforts, including names and addresses of those we have met with, can be provided under separate cover should Planning staff wish to review. However, the Club did not receive any negative comments through this outreach process about the proposed project. One fence-line neighbor shared his opinion that coast redwoods can thrive at the golf course. However, most neighbors have been generally supportive of the proposed modernization and sustainability plan in addition to the many members of the Club that live near the course. One member of the community did make contact with Club representatives outside of this outreach process and expressed concern about the number of trees being proposed for removal. We are also aware that a Club member and neighbor has written to the Town on a number of occasions in opposition to the modernization and sustainability plan approved by the full club membership. In addition to her written outreach, she has toured both staff and town officials around the property without notifying Club officials. We have offered to meet with her on over a dozen occasions to review concerns and also try to address factual misunderstandings being made in this correspondence without any success. We look forward to working collaboratively with the Town so the Club can undertake this comprehensive golf course modernization project to make it more environmentally sustainable and enjoyable for future generations. With this fourth submittal, the Club believes the project applications are suitable to be deemed complete. As previously discussed, the Club is eager to have the Planning Commission review the project applications for approval in mid-August to allow sufficient time for building permits to be obtained before construction commences in March 2026. If you have any questions or would like additional information, please contact me directly at 408-402-7468 or via email at akimball@larinconadacc.com. Sincerely, Andy Kimball, PGA General Manager La Rinconada Country Club Page 301 1 Exhibit 1 Golf Course Modernization Project - Tree Removal Permit (Permit No. T25-013) Proposed Tree Removal, Replacement and Protection Explanation TREE REMOVAL Background Information A critical element of the course modernization project is to reduce water usage through a reforestation program by planting new drought tolerant grasses, shrubs and native trees that are better suited for our climate zone. Many of the trees originally planted and subsequently added to the site over the past 60 years are non-natives designed to improve playability on the golf course by separating fairways. A large percent of the introduced trees are eucalyptus and coast redwood. At the time of their planting, consideration was not given to mature tree size and structure, future climate change and excessive water requirements. In recent years more than 100 trees have fallen on the course after storms or died, as a result of drought despite the Club’s considerable efforts to maintain them. Equally important, the new drought tolerant grass requires more sunlight and many of the non- native trees will prevent new grasses from growing successfully due to a combination of factors including narrow fairways, tree heights and density, predominantly redwoods, resulting in excessive shading. The Club currently maintains over 1,200 mature trees across its property including non-tagged trees outside of the project area. To achieve our water reduction goals and course layout plans, we are requesting the removal of approximately 240 trees, primarily non-native eucalyptus and coast redwoods that were originally planted in the 1950s and beyond. In addition, the project arborist has identified an additional 47 trees that may pose future hazards and recommends them for removal as part of the project which, and the Town’s consulting arborist peer review concurs with this assessment. The final number of trees proposed for removal is 287. We are also proposing a reforestation plan to replant 173 trees, primarily native oaks, in 24 to 60-inch boxes, and will also pay more than $75,000 in lieu fees after Town staff makes a final calculation to support the Town’s urban reforestation program elsewhere in the community. (See the calculation table at end of document.) The net result is that a similar number of trees will remain on the course when the project is complete, and tree removal proposed will not change the character of the neighborhood. Better planning and consideration to tree location, along with the planting of more indigenous trees, should allow for a successful transition to the water saving Bermuda grass which will be the predominant grass on the fairways, resulting in a less water dependent golf course. New plantings will also rejuvenate, and contribute to diversification of the urban forest. We anticipate many of the mature trees proposed for removal will likely be lost over time due to the significant water demand that will no longer be provided through irrigation and inability to adapt to our changing climate. Most of the trees proposed for removal are on the interior of the course and Page 302 2 are also required to be removed for the new course layout and to achieve a less water dependent design. Our plan will retain and enhance the neighborhood character and the Town’s urban forest by planting more native, drought tolerant and climate responsive trees to avoid further tree loss. We commissioned an arborist’s report by Trees360 Degrees, a Certified Arborist, who analyzed trees on the property within the project area, including information about the condition of trees proposed for removal as required by the Town’s guidelines. This includes the identification of all protected tree species, size (trunk diameter, canopy height, and spread), health, structure, form, and location on the property. The report assesses the condition of the trees with respect to: (a) disease, (b) imminent danger of falling, (c) structural failure, (d) proximity to existing or proposed structures, (e) structural damage to a building, or (f) a public nuisance caused by a tree. The final updated, revised report is dated July 1, 2025 addresses all Town staff comments and input from the Town’s consulting arborist peer review. Many of the trees, proposed for removal are already in poor condition. Given their location on site, the new course design (being more water efficient and requiring more sunlight to the fairways) will most likely add to their further decline in tree health. Ultimately, if not removed, they would impede the proposed design of the golf course preventing the Club from achieving its water reduction goals and create ongoing safety issues. The trees proposed for removal will not result in a change or decrease in density of tree coverage that is inconsistent with the current golf course as it will maintain over 1,100 trees on site when the project is complete. There will not be a substantial adverse change in the site's aesthetic or biological significance, primarily because the trees proposed for removal will not affect the topography of the course, nor will it trigger erosion, soil loss, diversion or increased flow of surface waters. In addition, the plan primarily avoids removal in potentially sensitive areas on site or along the perimeter near existing residents (unless they are sick, dying a hazard or unsightly), preserving the character of the surrounding neighborhood. Finally, if the trees proposed for removal are not permitted, they will have a significant impact on the property in that they will unreasonably interfere with the golf course’s normal and intended long term use due to the location, size, or condition of the trees which cannot be managed through normal maintenance. The number of trees the golf course can adequately support under similar conditions, including sustainability goals for water reduction and ongoing course operations, is limited and some of the protected trees if not removed will impede the health of other protected native trees on site. This will restrict the economic enjoyment of the property and create a hardship by precluding the Club from achieving its long-term sustainability goals, especially water reduction by planting of drought tolerant grasses, that other courses in the region have undertaken including the Sharon Heights Golf Club in Menlo Park, Palo Alto Hills Country Club in Palo Alto, Palo Alto Municipal Golf Course, Lake Merced Golf Club in Daly City, and The Olympic Club in San Francisco. Page 303 3 Reasons for Removal of Coastal Redwood Trees in Los Gatos Chaparral 1. Ecological Incompatibility and Habitat Disruption Coastal redwoods (Sequoia sempervirens) are native to cooler, fog-rich coastal environments and do not naturally belong in the hot, dry chaparral ecosystem typical of Los Gatos in the golf course area. Their presence disrupts the ecological balance by significantly altering native plant communities. The dense canopy of redwood trees blocks sunlight, changes soil moisture profiles, and creates a cooler and moister microclimate that is unsuitable for many drought- adapted chaparral species. The intent of this project is to reduce reliance on irrigation water by 30% to 40% over current practices. 2. Excessive Water Use in a Drought-Prone Region One of the most compelling reasons for their removal is the excessive water demand of coastal redwoods. In their native foggy habitats, redwoods supplement their water needs by absorbing moisture directly from the air—accounting for up to 40% of their annual intake. However, the area of Los Gatos around the course does not experience coastal fog during the summer. As a result, redwoods planted in this area rely heavily on irrigation to survive. In the context of ongoing drought conditions and increasing water restrictions across California, maintaining these non-native trees is an unsustainable and irresponsible luxury. Their high water demands put strain on the irrigation systems and divert vital resources from native or drought-tolerant turf and landscapes more suitable for chaparral conditions. 3. Resource Heavy Burden and Landscape Management From a landscape management perspective, the redwoods at La Rinconada Country Club require constant attention due to their inappropriate planting locations. Their dependence on irrigation, combined with their rapid growth and large biomass, increases both financial and labor costs for maintenance. Removing these trees would reduce the need for costly water use and maintenance while allowing for a transition to more sustainable, native landscaping that aligns with state and local conservation goals. Reasons for Removal of Eucalyptus Trees in Los Gatos Chaparral The second largest tree species requested for removal, after the coast redwoods, are Eucalyptus, predominantly Eucalyptus camadulensis (river red gum). The river red gum, so accurately named, is a riparian tree in their native Australia and can grow to massive sizes in both height and spread, requiring both large amounts of water and high maintenance requirements in urban settings. These trees are renowned for summer branch drop, which is a concern when the trees are growing in high traffic areas for pedestrians, cars, and carts alike. The river red gum is also a prolific self-seeder and can be problematic for control and invasion of our oak woodland chaparral habitats. Ultimately, the genera of Eucalyptus are also known to be highly flammable due to the oils in the leaves, bark, and wood. When they burn, they create Page 304 4 intense fires releasing oils into the atmosphere which can contribute to the rapid spread of a wildfire. Conclusion While majestic and ecologically significant in their native coastal habitats, coastal redwood trees are ill-suited to the chaparral environment of Los Gatos. We believe their removal, along with the Eucalyptus, is a step toward restoring ecological balance, conserving water resources and managing fire risk effectively. Transitioning to more native or climate-adapted trees will better support the local ecosystem, reduce maintenance costs, water use, and promote long-term sustainability. TREE REPLACEMENT AND REPLANTING PLAN Given the unique requirements for golf operations and the inherent limitations created by the course layout with narrow fairway corridors and mature trees proposed for preservation, it is only feasible to re-plant 173 new trees on the site. To meet the Town’s replacement ratio preferences, the applicant is proposing a tree replacement plan that includes larger 48 and 60 inch boxed trees of primarily native oaks which exceed the Town’s standard 24 and 36 inch boxed tree requirements. See table below that summarizes the applicant’s tree replanting obligation based on tree canopy size and associated replacement plan. The table shows the number of 24 inch boxed trees that would be required for planting to satisfy the Town’s replacement requirements. Because the Town’s tree protection ordinance does not provide 24 inch boxed tree equivalencies for 48 and 60 inch boxed trees, the applicant proposes a logical method for determining 24 inch boxed credits for each of these tree sizes that simply extends the 2:1 ratio for 24 to 36 inch boxed trees for each size. In addition, significant in lieu fees would come with approval of the application to support the Town’s urban reforestation plan in the neighborhood and other areas of the community. Page 305 5 In summary, the applicant is proposing to remove 287 trees, although some may be exempt under the Town’s tree protection ordinance. The applicant seeks approval to replant 173 trees of varying sizes and types as shown on the landscape planting plan sheets, including fifty 48 inch and twenty-three 60 inch boxed oaks, and provide the in lieu fee calculated by the Town to satisfy the balance of the replacement obligation and support the Town’s urban forestry plan. TREE PROTECTION | CHANGE IN TREE FENCING MATERIAL The Club has proposed a detailed tree protection plan which is supplemented by recommendations in the final project arborist report dated July 1, 2025. The applicant also seeks modification and augmentation of the Town’s typical tree fencing material specifications for developed parcels which do not work effectively on large open space projects like the golf course. The tree protection plan sheet identifies locations where orange netting is appropriate as alternative to fencing based on the project’s arborist’s guidance. The project arborist reviewed the final plan and work to be done in and around the areas of the trees and noted their level of proposed impact based on these drawings. The arborist recommends using alternative fencing materials in low-to-no-impact areas and a combination of high-visibility plastic and metal chain link fencing in areas where moderate impacts are predicted. All areas of potential high impact should have the chain link fencing installed, as previously noted in arborist’s report. Due to the scope of the project, with a large number of trees and areas to be fenced, along with the proposed goals to retain as many trees as possible, the use of the orange fencing will aid in making sure the project is executed to meet these goals. The reduction in cost for the material and for the workforce to install and move metal fencing can be transferred to more physical onsite presence of an arborist or appointed staff to ensure that ALL areas are being restricted from access for tree protection. The orange fencing will also allow for the convenience of shifting from area to area as the project moves along with construction will be performed in phases, and access to critical areas that may require supervised work by hand can be more effectively managed. Finally, the bright color will also improve visibility. Page 306 TREE REPORT For La Rinconada Golf & Country Club 14595 Clearview Dr. Los Gatos 95032 GOLF COURSE MODERNIZATION PROJECT Lisa Edwards & Straun Edwards Trees 360 Degrees Certified Arborist #WE-5055A / #WE-5612A Ph. (408) 455-5911/408-898-0625 July 1st, 2025 (Revised July 17th, 2025) EXHIBIT 6Page 307 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 SUMMARY ................................................................................................................................................1 INTRODUCTION......................................................................................................................................2 BACKGROUND .........................................................................................................................................2 ASSIGNMENT ............................................................................................................................................2 LIMITS OF ASSIGNMENT .......................................................................................................................3 PURPOSE AND USE OF REPORT ...........................................................................................................4 OBSERVATIONS .......................................................................................................................................4 TREE INVENTORY ...................................................................................................................................4 PLAN REVIEW...........................................................................................................................................5 ANALYSIS ..................................................................................................................................................6 SPECIES COUNT .......................................................................................................................................7 SPECIES STATUS ......................................................................................................................................7 CONDITION RATING ...............................................................................................................................8 EXPECTED IMPACT LEVEL .................................................................................................................10 REMOVALS..............................................................................................................................................11 MITIGATION FOR REMOVALS ............................................................................................................11 DISCUSSION/CONCLUSION .................................................................................................................12 APPENDIX A: SPECIES BREAKDOWN ...............................................................................................14 SPECIES DIVERSITY ..............................................................................................................................14 TREE REMOVALS...................................................................................................................................15 TREES TO RETAIN .................................................................................................................................16 APPENDIX B: TREE PROTECTION GUIDELINE IMAGES ...............................................................17 TRUNK PROTECTION ............................................................................................................................18 BRIDGING ................................................................................................................................................19 TRENCHING ............................................................................................................................................19 AIRSPADE ................................................................................................................................................19 APPENDIX C: PROJECT REQUIREMENTS .........................................................................................20 PROJECT ARBORIST ..............................................................................................................................20 VERIFICATION OF TREE PROTECTION AND MAINTENANCE.....................................................20 REGULAR MONITORING REPORTS ...................................................................................................20 SPECIAL ACTIVITY MONITORING NOTIFICATION .......................................................................20 STAGING AND HAUL ROUTE ..............................................................................................................20 FENCING/TREE PROTECTION ZONE (TPZ) ......................................................................................21 FENCING MATERIAL FOR TPZ ............................................................................................................21 LOCATIONS .............................................................................................................................................22 TRUNK PROTECTION ............................................................................................................................22 SIGNAGE ..................................................................................................................................................22 PRUNING AND REMOVALS .................................................................................................................23 PRUNING STANDARDS .........................................................................................................................23 TREE REMOVAL CRITERIA STATEMENT.........................................................................................23 Page 308 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 EARTHWORKS ........................................................................................................................................23 GRADING AND DRAINAGE..................................................................................................................23 SOIL COMPACTION MITIGATION ......................................................................................................24 TRENCHING-UTILITIES/DRAINAGE/IRRIGATION ..........................................................................24 ROOT PRUNING ......................................................................................................................................24 IRRIGATION ............................................................................................................................................25 TEMPORARY IRRIGATION...................................................................................................................25 PERMANENT IRRIGATION FOR TREE APPLICATION ...................................................................25 TREE CANOPY DUST CONTROL .........................................................................................................26 TREE DAMAGES, DEPOSITS, PLANTING & FINAL INSPECTION .................................................26 DAMAGES ................................................................................................................................................26 TREE APPRAISAL ...................................................................................................................................26 TREE REPLACEMENT REQUIREMENTS............................................................................................27 FINAL INSPECTION ...............................................................................................................................27 ADDENDUM ............................................................................................................................................28 FINAL STATEMENT ...............................................................................................................................29 BIBLIOGRAPHY ......................................................................................................................................30 Page 309 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 1 of 30 SUMMARY The applicant is requesting approval for site improvements to modernize the existing golf course. The golf course is zoned RC — also known as Resource Conservation Zone — an area used at a minimum to enhance open space and preserve wildlife, watersheds, and vegetation. The intent is to return the course to a more sustainable environment by minimizing the number of impervious cart paths and changing to a more drought-tolerant and indigenous landscape, thus reducing water consumption. According to the Town Code Sec. 29.10.0955, “native means any tree that is found in the immediate natural habitat.” As this project relates to trees, there will be a shift to replace many non-native trees with native species naturally occurring in the Los Gatos area. For example, the coast redwood, while the most prominent tree species growing on the course, is not indigenous to the oak woodlands and chaparral areas of Los Gatos, but to the Santa Cruz mountains. Moreover, it is not conducive to the golf course’s specific climate. As the fog belts shift in California along with the high water intake these trees are accustomed to, they are facing a drastic change, and it seems reasonable to reduce the quantity while proposing a remodel. In addition to the redwoods, the Eucalyptus is a non-native tree species that can be a safety hazard due to the risk of falling limbs and fuel potential for fires. The site improvements require a moderate amount of earthwork to be executed, including grade changes for course contours, improved drainage, and an upgrade to the current irrigation system. The modernization project requires some tree removals and replacements; therefore, a tree inventory has been completed. The inventory contains a total of 945 mixed-species trees. In addition to the inventoried trees, naturalized greenbelt areas outside the project scope, which are expected to be unimpacted, exist and have been identified on the Grading and Drainage Plan Sheets C-1.0 to C-1.5 rev. date 03/28/25. Of the 945 trees tagged, 790 are considered Protected trees, 92 are Large protected trees, and 63 fall into the exempt category due to their smaller size, undesirable species, or both. As of the writing of this report, one tree has been removed by Pacific Gas and Electric Company, and is not included in the inventory, leaving 287 proposed for removal and 658 proposed for retention. According to the ordinance requirements and based on the removal requests, the applicant will be required to replace the removal trees with (977) 24-in. boxed trees or a combination of trees and in-lieu payment. The final decision on planting and payment configuration is to be confirmed by the Town arborist. Tree protection for the remaining trees is outlined in this document, and the tree protection fencing locations are identified on the Preliminary TP Plan sheets TP-1 through TP-5 dated 03/28/25 and revised 07/01/25. Final adjustments for tree protection fencing will be made in the field before work Page 310 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 2 of 30 commences. The TP plan sheets shall also include this report outlining the required tree protection recommendations. Appraisal values were calculated for 732 of the 945 trees that are determined to be in Low to High-impact areas. The remaining 213 tagged trees are in zones designated as "Area Not Part of Project," such as the driving range, pool, and clubhouse parking lot. The 732 were appraised for a rounded depreciated value of $13,458,393. INTRODUCTION BACKGROUND La Rinconada Golf and Country Club is a private member club with an 18-hole course in Los Gatos, California. Other amenities include a restaurant, heated spa, swimming pool, gym, yoga studio, and bocce courts. In November of 2024, LRCC tasked Trees 360 Degrees with assessing the trees and the proposed changes required to upgrade the existing golf course and provide a report with our findings and recommendations for tree protection to satisfy the Town of Los Gatos Planning Department requirements. ASSIGNMENT: • This assignment is to provide La Rinconada Golf and Country Club with an arborist report to use for submission to the Town of Los Gatos Planning Department to obtain the necessary permits for the proposed golf course renovation project. • The arborist report includes an assessment of the trees within and adjacent to the proposed project area. It consists of affixing a numbered tree tag to each tree trunk, species identification, trunk diameter measurement, approximate canopy height, and spread, overall condition ratings based on health, structure, and form, and suitability for preservation. The tree tag numbers are for reference on-site and correlate to site plans provided for review. • Provide tree protection guidelines and specifications set forth by the Town of Los Gatos Tree Protection and impact ratings for those trees impacted by the project. • Provide appraised values using criteria collected during our site visits, professional experience, and formulas written by The Council of Tree and Landscape Appraisers in the Guide for Plant Appraisal, 10th Edition, Second Printing. Page 311 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 3 of 30 LIMITS OF ASSIGNMENT • This report and the contents thereof represent the professional opinion of the arborist or appraiser. The arborist or appraiser fee is not contingent upon reporting a specific value or providing predisposed findings. • While the arborist or appraiser cannot guarantee the accuracy or information provided by others nor be held responsible, great care has been taken to seek reliable sources and verify the information obtained as much as possible. • The information in this report is limited to the trees' condition during the time the trees were inspected between November 13th, 2024, and January 13th, 2025. No risk assessments were performed on any of the trees. • The information collected was used to apply condition ratings and was a visual assessment at ground level only. Tree heights and canopy spreads are estimates, while the trunk diameters were measured. There is no guarantee that issues or deficiencies of the examined trees or property will not arise in the future. • The final plans reviewed included the Architectural and Site Review Plans compiled by HMH dated July 1st, 2025). The photos of trees on-site that have been inserted as hyperlinks into the tree inventory were provided by La Rinconada Golf and Country Club. • The sketches or drawings in this report are solely for visual aid and are not to scale or architecturally sound representations. • Unless otherwise required by law, the possession or use of this report – whether it be an original, copy, or electronic version – has no implied right of publication or use, other than expressed in the given assignment of this report unless permitted by the authors. • Unless further contractual arrangements are made, the arborist or appraiser shall not be required to participate in any litigation, attend court, or give testimony due to the contents of this report. • Deletion or alteration of any portion of this document invalidates the report. Page 312 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 4 of 30 PURPOSE AND USE OF THE REPORT This report is intended to identify all the trees within the current boundary of the golf course that could be affected by the proposed renovation project. The report is to be used by La Rinconada Golf and Country Club for submittal to the Town of Los Gatos. This document should be used by the Town Planning Department and Town Arborist to reference existing tree conditions and help satisfy planning requirements while acting as a general protection guide for the trees for all parties involved in the project before, during, and post-construction. OBSERVATIONS TREE INVENTORY All observations made in the field have been recorded in the tree inventory. The inventory consists of trees located on-site and those near project activity on neighboring properties that have been identified as protected from removal unless permitted by the Town of Los Gatos in the Town code ordinance DIVISION 2.–TREE PROTECTION. • Per "Sec. 29.10.0960. – Scope of Protected trees": This includes specifically those trees with a four-inch or greater diameter (twelve and one-half-inch circumference) of any trunk and any stand of trees, the nature of which makes each dependent upon the other for survival. • Per "Sec. 29.10.0955. – Definitions": Large Protected are trees described as any oak (Quercus sp.), California buckeye (Aesculus californica), or Pacific madrone (Arbutus menziesii) which has a 24-inch or greater diameter (75-inch circumference); or any other tree species with a 48-inch or greater diameter (150-inch circumference). For this inventory, only the oaks with a 24-inch diameter or greater and any other species with a 48-inch diameter or greater will apply; there are no buckeyes or madrones to account for. The inventory also considers any exceptions to the provisions, and we have labeled them Exempt. • Per "Sec. 29.10.0970.– Exceptions,": States the following trees are excepted from the provisions of this division and may be removed or severely pruned without Town approval or issuance of a tree removal permit: (2) Any of the following trees that are less than twenty-four (24) inches in diameter (seventy-five (75) inches in circumference): Page 313 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 5 of 30 The inventory details include tree identification of botanical and common names, trunk diameter and canopy measurements, overall condition ratings, appraised value, and recommendations for their care or removal. The information has been formatted in a spreadsheet and submitted along with this report. The diameter at breast height (dbh) is the measurement of the trunk diameter at 4.5ft (54-inches above natural grade) on a single trunk specimen. Multi-trunk trees are measured at the same height, but the individual trunk measurements are combined to calculate the sum of all trunk diameters. This calculation follows the guidelines per the Town code "Sec. 29.10-0955 – Definitions…Diameter." Any removal recommendations are made considering the criteria for removal outlined in "Sec. 29.10.0985. – Determination and conditions of permit". We have determined that the most fitting criteria for this project are listed in the Project Requirements and Protections Measures, subsection Tree Removal Criteria Statement (Criteria per Town code Sec. 29.10.0992) listed on page 23 of this report. Replacement tree quantity and sizes have also been suggested based on what is defined in Town code "Sec. 29.10.0985 – Determination and conditions of permit". A condensed version of this table is viewable on page 27 of this report. Finally, due to the size of this project, photo links have been added to the spreadsheet for use on demand. PLAN REVIEW Specific attention was given to the following plan sheets related to the trees on site in the Architectural and Site Review Plans and the TP sheets revised 07/01/25. • Civil Drainage and Utility sheets C-0.0 to C-1.5 provided by Clifford Bechtel and Associates, LLC • Demolition Plan sheets AO-2, AO-3, and Cart Path Plan sheet AO-11 provided by Todd Eckenrode of Origins Golf Design • Landscape Construction Document sheets, including Tree Protection and Removal Plan Sheets TP1-TP6, Irrigation Plan Sheets IP1-IP6, Planting Plan Sheets PP1-PP-5, and Planting Detail Sheets PD1-PD2 provided by Pinnacle Design Company • Preliminary Entry Road Grading and Drainage, Interim Erosion Control Measures, and Fire Access Plan C4.0-C6.0 provided by HMH. a. Black Acacia (Acacia melanoxylon) e. Red Gum Eucalyptus (E. camaldulensis) b. Tulip Tree (Liriodendron tulipifera) f. Other Eucalyptus sp. (E. spp.) Hillsides only c. Tree of Heaven (Ailanthus altissima) g. Palm (except Phoenix canariensis) d. Blue Gum Eucalyptus (E. globulus) h. Privet (Ligustrum lucidum) Page 314 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 6 of 30 ANALYSIS The data collected for the tree inventory spreadsheets has been used to determine the total number of species on site as well as the breakdown of species variation, identification of native vs. non-native specimens, status of protected trees, the condition rating of trees at the time of inspection, with the overall condition rating based on the lowest rating of the three, the expected level of impact to the trees, number of removals required to fulfill the project requirements and the recommended replacements and protection of retained trees. In addition to the tree inventory, the plan set provided by HMH for the project's overall scope was reviewed, and suggestions were provided to the architecture and design team during the planning phase. The plan set will show all tree protection fencing at a minimum outside the tree canopy driplines and extend fencing around groups of trees where applicable. Contractors shall execute construction activities (e.g., drainage, grading, and mainline irrigation installation) outside the designated tree protection zones. At the time of our review of the revised documents dated July 1st, 2025, consideration of our recommendations appears to have been applied. All other areas that remain a concern have been labeled with an impact rating of Low to High, and a protection measure protocol has been advised at the end of this document. Page 315 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 7 of 30 SPECIES COUNT Per the data collected, there are 945 tree species with a mix of 49 genera. The breakdown of native trees .is based on the indigenous oak woodland and chaparral areas of Los Gatos, with 151 native to 794 non- native trees, the latter being trees that belong to geographical areas outside Los Gatos. SPECIES STATUS The species status is based on the Town of Los Gatos Tree Protection guidelines. The trees that have been inventoried are labeled as one of three categories: Protected = any tree with a dbh of 4 inches or greater, Large Protected = any of the three genera listed in the ordinance Sec. 29.10.0955 with a 24-in dbh or greater plus any tree with a 48- in. dbh or greater, and finally, those that are Exempt. The Exempt trees = exceptions to the rule that are designated species and smaller size dbh listed in Sec. 29.10.0970-Exceptions. These exceptions were previously detailed in this document. The breakdown of the inventoried trees includes 790 Protected, 92 Large Protected, and 63 Exempt. See the chart below for the division of trees proposed for removal vs. retained. 287 PROPOSED REMOVALS 658 RETAINED TREES • 263 Protected Status (261 non-native/2 native) • 527 Protected Status (426 non-native/101 native) • 16 Large Protected (15 non-native/1 native) • 76 Large Protected (29 non-native/47 native) • 8 Exempt (all non-native) • 55 Exempt (all non-native) 151 794 Native Vs. Non-Native Trees Native Non-Native Page 316 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 8 of 30 CONDITION RATING Species age and diversity do not come as a surprise, seeing that the course was initially built in 1929, is closing in on 100 years of operation, and consists of approximately 125 acres. The course is heavily tree-lined with mature specimens of various ages. The condition rating of a tree reflects the species' characteristics and stage of development at the time of inspection. The tree's health, structure, and form are all determining factors. To assess the trees at La Rinconada, we used qualitative terms (Dead, Very poor, Poor, Fair, Good, and Excellent) and percentage ratings (0%-100%), with 100% being Excellent and 0% being Dead. These classifications are based on the rating categories defined in The Council of Tree and Landscape Appraisers Guide for Plant Appraisal, 10th Edition, Second Printing. A summarized version is listed below. Per our assessment, La Rinconada has two hundred and twelve trees in Excellent condition (81%-100%), two hundred and sixty are in Good condition (61%-80%), one hundred and eighty-five are in Fair condition (41%-60%), one hundred and twenty-seven are in Poor condition (21%- 41%), one hundred and fifty-nine are in Very poor condition (6%-20%). Two are dead (0%-5%). Page 317 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 9 of 30 SUMMARIZED VERSION OF CONDITION RATINGS USED FOR ASSESSMENT • 81%-100% = Excellent: Nearly perfect health, defect-free structure, and symmetrical form. • 61%-80% = Good: Normal vigor, no visible pest or disease, twig/foliage dieback minor, the structure is well-developed, defects, if any, are correctable, minor asymmetries of the canopy that do not compromise overall appearance. • 41%-60% = Fair: Reduced vigor with visible damage from pest or disease that is non-fatal, a structure with one or more significant defects that would require multiple treatments over time to correct and form that is asymmetrical from species norm and compromise overall appearance. • 21%-40% = Poor: Low vigor, extensive twig dieback, foliage density, and color are abnormal, pest and disease may be fatal, structure is severely compromised with serious defects that cannot be corrected and failures likely to occur, form is extremely asymmetrical and aesthetics and intended use negatively impacted. • 6%-20% = Very Poor: Appears to be dying, failure is probable, and overall appearance unsightly- detracts from intended use in the landscape. • 0%-5% = Dead: Minimal to no life 0 50 100 150 200 250 300 Number of TreesOvrall Condition Based on Lowest Rating Condition Ratings For LRGCC Trees 22.43% Excellent 27.51% Good 19.58% Fair 13.44% Poor 16.83% Very Poor 0.21% Dead Page 318 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 10 of 30 EXPECTED IMPACT LEVEL The impact level, classified as none, low, moderate, or high, indicates how a tree may be damaged by construction activities. Factors considered are changes in grade, hardscape installation or removal, drainage, trenching, and irrigation at a minimum. The levels of impact are described below. • None/No Impact = No construction activity-tree unaffected. • Low Impact = Construction activity will have minimal impact on the tree. • Moderate Impact= Future structural or health issues could result from the construction activity; precautions must be made to keep the tree from being negatively affected. • High Impact= Removal or alternative measures must be implemented to provide the best possible outcome for the tree's survival because the tree's health and structure are already compromised or will be jeopardized by close construction activities. After reviewing the plans listed above, I have come to the following conclusions on the expected impact of the trees inventoried. Of the 945 trees inventoried, 219 (23.17%) will have no impact (213 of those are excluded from the work area), 193 (20.42%) will have Low Impact, 319 (33.76%) will have Moderate Impact, and 214 (22.65%) will have High Impact. A further breakdown reveals a single tree with no apparent impact, 48 trees with low-impact, 81 moderately impacted, and 157 highly impacted that are proposed for removal. All trees listed in the inventory as Low-High that remain on-site will require monitoring by an ISA-certified arborist when construction activities take place near these trees. The trees designated with high impact have been noted due to multiple construction activities proposed to take place (e.g., cart path installation or removal, change in grade nearby, and storm drain installation). These combined activities may take place on multiple sides of the tree. These trees will require extra care and may necessitate grading or storm drain locations to be 0 50 100 150 200 250 300 350 1 IMPACT RATINGS 219 No Impact 193 Low Impact 319 Moderate Impact 214 High Impact Page 319 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 11 of 30 adjusted in the field while the work is being executed. The construction crew, architect, or appointed personnel shall work together with the arborist on-site. REMOVALS At the time of this report, 287 trees have been listed for removal. This number was revised from the submitted report dated April 25th,2025. The revised count combines the original 240 and the additional recommended 47 trees that have been identified as HR (Hazard Removal) in the updated inventory spreadsheets. Our professional opinion is that those protected trees, as part of the redevelopment of La Rinconada Golf Course, fall under the criteria guidelines, but are not limited to the following. The trees have low overall condition ratings or poor structure that would pose a threat to the public use of the property as they are dead, dying, severely diseased, decayed, or disfigured and cannot be returned to a healthy and structurally sound condition (Criteria 1). They may be crowding other protected trees of greater significance (Criteria 3). The trees conflict with the proposed development and land improvements, restricting the economic enjoyment of the property (Criteria 4). The removals and replacements will allow the property to transition towards a more native oak woodland landscape like the indigenous oak woodland and chaparral area of Los Gatos (Criteria 10). The accompanying tree inventory spreadsheet should be referenced for details. MITIGATION FOR REMOVALS The tree mitigation requirements are outlined in the Project Requirements and Protection Measures, subsection Tree Replacement Requirements, on page 27. Suggestions for species quantity and size are based on the Town Requirements and listed in the inventory spreadsheet. The number of estimated trees to be replanted is (977) - 24in boxed trees. However, it may be possible to plant a combination of larger-sized trees and/or in lieu payments to meet the required replacements. Per the current Landscape Planting Plan sheet PP-2, 158 trees are suggested for replanting, plus 15 additional trees with planting locations to be finalized in the field. These replacement trees are of 977 Quantity & Size of Replacement Tree 24-in. Page 320 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 12 of 30 various sizes, including 24-in., 36-in., 48-in., and 60-in. boxed specimens; a mix of (121x) oaks, (39x) madrones, and (13x) sycamores. It is highly recommended that the native trees, Indigenous to the area of Los Gatos, be utilized whenever possible (e.g., Quercus douglasii in high, dry, well-draining locations, Q. agrifolia in well-drained areas with moderate water, and Q. lobata in wetter areas that have deep, well-draining, fertile soil that is also preferably dry in summer). The final tree replacement count, size, and species will be designated on any permits issued by the Town of Los Gatos. DISCUSSION & CONCLUSION: For La Rinconada Golf Course's modernization project, the proposed work entails changing the contours and upgrading bunkers, greens, cart paths, fairways, irrigation, and drainage. It is my understanding that all materials will remain on-site. The condition of the trees is mixed with a combined 69.52% Fair to Excellent rating, 30.27% Very Poor to Poor rating, and an insignificant 0.21% for Dead trees. The new look of the course will include the removal of a significant number of non-native trees and the replanting of native trees and shrubs alike. Of the 945 trees, 63 are Exempt, leaving 882 trees classified as protected, with 92 of those Large Protected. Overall, the proposed construction is expected to have some level of impact on all but 219 trees. Of the recommended removals, there is only 1 with no apparent impact, and the following are in areas with various degrees of impact: 48-low impact, 81-moderate impact, and 157-high impact. These trees are either in direct conflict because they are too close to the proposed changes, do not harmonize with the goals of the new course layout, are non-native with high water needs, or are poor specimens with no valuable contribution to warrant their retention, or a combination of the above. Over fifty percent of the trees recommended for removal are non-native trees, including redwood, Eucalyptus, and Ash. One of the goals is to reduce water consumption on the course, and the redwood trees make up the vast majority of the existing species. If the removals are approved, all the remaining trees inventoried must be protected, as indicated in this document. Furthermore, the applicant must replant based on the Town of Los Gatos mitigation requirements. At this time, we have calculated replacement trees based on the canopy size of the removals that have been proposed. The estimated number of trees is 977- 24in boxed, or an approved combination of the two. The Town will determine the total tree quantity, species, size of replacement trees or payment in place of planting once a permit is issued. The plans provided and reviewed appear to be accurate, with details applied for tree protection. All tree protection zones have been designated on the Tree Page 321 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 13 of 30 Protection and Removal Plan sheets TP-1 to TP-6. These sheets were recently updated on 07/01/25 under our consultation and guidance, with details addressing the breakdown of areas and types of fencing proposed. The reasoning for the selected areas and fence material to be used is based on our perceived levels of impact from the construction. The arborist will adjust as necessary and approve all final fencing locations in the field before breaking ground on this project. All construction projects around trees shall promote a positive outcome for the long-term preservation of the tree. The construction process and on-site teams need to understand that tree preservation is a top priority, and the work around them needs to be fluid. Similarly, the landscape installation plans must be reviewed once plant materials and locations are finalized. No large-sized trees/plants at full maturity or large-scale plantings shall occur directly under the canopies of already existing, mature, large-sized trees. It is highly recommended that the plantings be limited to outside the drip line and, where possible, native material with similar irrigation needs be planted. Additionally, special consideration should be given to the large native oak trees (e.g., Quercus douglasii -Blue oaks) that tend to thrive best on seasonal dry, well-drained soils in full sun on slopes and hillsides. Please see the details below in the Project Requirements and Protection Measures section. These details shall be adhered to and copied onto the Tree Protection Plan Sheet Set. Page 322 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 14 of 30 0 50 100 150 200 250 300 350 400 LRGCC SPECIES DIVERSITY CHART 1-Acacia baileyana Cootamundra wattle 20-Acacia dealbata silver wattle 1-Acacia melanoxylon black acacia 1-Angophera floribunda smooth-barked apple RR 1-Araucaria heterophylla Norfolk Island pine *2-Betula pendula European white birch RR 1-Brachychiton populneus Kurrajong Bottle RR 2-Butia capitata Pindo palm 3-Calocedrus decurrens Incense cedar RR 7-Casurina sp. casurina RR 1-Catalpa bignoniodes Southern catalpa 1-Crataegus laevigata hawthorn RR 2-Cedrus deodara Deodar cedar RR 10-Cupressus arizonica Arizona cypress 132-Eucalyptus camaldulensis river red gum 3-Eucalyptus globulus blue gum 1-Eucalyptus polyanthemos red box 5-Eucalyptus sideroxylon red ironbark RR 14-Eucalyptus sp. Eucalyptus 2-Eucalyptus viminalis manna gum RR 20-Fraxinus excelsior European ash *1-Fraxinus oxycarpa Raywood ash RR 37-Fraxinus uhdei Shamel ash *30-Fraxinus velutina Modesto ash RR 22-Lagerstroemia sp. crape myrtle 3-Ligustrum lucidum Glossy privet RR 1-Liquidambar styraciflua sweetgum RR 4-Magnolia grandiflora southern magnolia 19-Olea europaea olive 9-Pinus canariensis Canary Island pine 16-Pinus halepensis Aleppo pine 2-Pinus radiata Monterey pine 1-Pinus silvestris Scotch pine 2-Pistachio chinensis Chinese pistache RR 22-Platanus acerifolia 'Columbia' London plane tree 1-Pyrus calleryana Callery pear 1-Pyrus kawakami evergreen pear 72-Quercus agrifolia coast live oak 45-Quercus douglasii blue oak 13-Quercus ilex Holly oak 34-Quercus lobata valley oak 1-Quercus suber cork oak 1-Quercus virginia southern live oak 5-Rhus lancea African sumac 1-Salix laevigata red willow 2-Schinus molle California pepper 362-Sequoia sempervirens coast redwood 8-Syagrus romanzoffiana Queen palm 1-Washingtonia robusta Mexican fan palm APPENDIX A Page 323 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 15 of 30 1 1 2 1 3 4 1 4 1 34 2 4 5 2 18 1 9 26 2 1 4 5 1 1 2 2 150 0 20 40 60 80 100 120 140 160 Angophera floribunda Araucaria heterophylla Betula pendula Brachychiton populneus Calocedrus decurrens Casurina sp. Crataegus laevigata Cedrus deodara Cupressus arizonica Eucalyptus camaldulensis Eucalyptus globulus Eucalyptus sideroxylon Eucalyptus sp. Eucalyptus viminalis Fraxinus excelsior Fraxinus oxycarpa Fraxinus uhdei Fraxinus velutina Ligustrum lucidum Liquidambar styraciflua Olea europaea Pinus canariensis Pinus halepensis Pistachio chinensis Quercus agrifolia Quercus douglasii Sequoia sempervirens 287 PROPOSED REMOVALS Proposed Removal Page 324 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 16 of 30 1 20 1 2 3 1 7 98 1 1 1 9 2 8 4 42 1 4 15 4 15 1 2 1 22 1 1 68 45 13 34 1 1 5 1 2 211 8 1 0 50 100 150 200 250 Acacia baileyana Acacia dealbata Acacia melanoxylon Butia capitata Casurina sp. Catalpa bignoniodes Cupressus arizonica Eucalyptus camaldulensis Eucalyptus globulus Eucalyptus polyanthemos Eucalyptus sideroxylon Eucalyptus sp. Fraxinus excelsior Fraxinus uhdei Fraxinus velutina Lagerstroemia sp. Ligustrum lucidum Magnolia grandiflora Olea europaea Pinus canariensis Pinus halepensis Pinus radiata Pinus silvestris Pistachio chinensis Platanus acerifolia 'Columbia' Pyrus calleryana Pyrus kawakami Quercus agrifolia Quercus douglasii Quercus ilex Quercus lobata Quercus suber Quercus virginia Rhus lancea Salix laevigata Schinus molle Sequoia sempervirens Syagrus romanzoffiana Washingtonia robusta 658 RETAINED TREES Retained Trees Page 325 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 15 of 34 APPENDIX B Crown drip line or other limit of Tree Protection area. See Tree Preservation Plan for fence alignment. TPZ-Tree Protection Zone may vary in radius from the trunk and may or may not be established at the drip line distance. See arborist’s report for specifications of TPZ radii. 8.5in. x 11in. sign laminated in clear plastic and spaced every 25-50ft. along the fence. KEEP OUT TREE PROTECTION AREA SECTION VIEW NOTES: • See Project requirements and Protection Measures Appendix E for additional tree protection requirements. • All maintenance and care shall be performed by a qualified and approved arborist with a C-61/D-49 California Contractors License. Tree maintenance and care shall be executed according to American National Standard for Tree Care Operations: Tree, Shrub and Other Woody Plant Management: Standard Practices parts 1-10 and adhere to ANSI Z133.1 safety standards and local regulations. • All maintenance is to be performed according to ISA Best Management Practices. Tree Protection Fence: Chain link fencing, a minimum of 6ft. in height, mounted on 2in. diameter galvanized posts, a minimum of 8ft. long, and pounded 24in. into the ground. Spacing for tube posts must be less than or equal to 10ft. on center. For extensive areas of protection with minimal impact, a high-density polyethylene fencing with 3.5in. x 1.5in. openings; Color- orange. Steel posts installed at 8ft. on center and 2in. x 6ft. steel posts or approved equal. 4-6in. layer of mulch. Maintain existing grade with the tree protection fence unless otherwise indicated on the plans. URBAN TREE FOUNDATION © 2014 OPEN SOURCE FREE TO USE Modified by Trees 360 Degrees 2025 Page 17 of 30 Page 326 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 18 of 30 APPENDIX B CONTINUED… TRUNK PROTECTION VERTICAL TIMBER DETAIL Sturdy Strap (steel, nylon, or synthetic rope) 2in. x 4in. or 2in. x 2in. 6ft. to 8ft. Tall Dimensional Lumber Spaces 3in. Apart. 6ft. Min. High density-High visibility orange polyethylene fencing wrapped against trunk, under boards. TRUNK PROTECTION WITH WATTLE 6ft. Min. Root Protection Zone. See Specs For Requirements 12in. diameter straw filled burlap wattles. Page 327 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 19 of 30 APPENDIX B CONTINUED… 4-6 inches of mulch tapered down towards trunk flare. 3/4-inch plywood or steel road plates Consider using Specialized Tool - Air Spade for soil excavation around roots within TPZ Horizontal Boring-Tunnel Under Roots No Trenching in TPZ Page 328 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 20 of 30 APPENDIX C PROJECT REQUIREMENTS & PROTECTION MEASURES • Project Arborist: The applicant shall retain a project arborist with a minimum International Society of Arboriculture Certification credentials. The Items that fall under the guidance of the project arborist shall include, but are not limited to the following. • Verification of tree protection and maintenance: The project arborist shall verify that all pre- construction conditions of approval for the project have been met and are in place before the initial demolition of any structure or earthwork. This includes but is not limited to, tree fencing, trunk buffers if applicable, signage, designated staging areas, and temporary irrigation. Verification will be done by attending a pre-construction meeting. The pre-construction meeting shall consist of all involved parties, at a minimum, the construction superintendent, pertinent personnel, the project arborist, and the Town-appointed consulting arborist. This meeting shall take place before breaking ground on the project. As mentioned above, this meeting will review root pruning protocols, tree protection, maintenance measures, and establishing/confirming staging areas and potential supplemental irrigation around trees. • Regular Monitoring Reports: Once work commences, and any time requiring supervision by the project arborist, it will be documented in writing, reflecting the reasons for the job, how it was executed, and if any further mitigation is required. Namely, all canopy and root pruning shall be performed or overseen by an ISA-Certified Arborist. The project arborist is responsible for visiting the site for progress reports monthly, at a minimum, throughout the project's life unless directed otherwise by the Town arborist. During these site visits, the status of trees, including tree protection measures and maintenance, shall be inspected and commented on in a brief letter/report sent to the Town Arborist via email per Town requirements. Photos may be included where and when deemed necessary. • Special Activity Monitoring Notification: Site personnel shall contact the Project Arborist, at a minimum, 48 hours in advance to facilitate monitoring of proposed activities that may disturb tree canopies or roots. The root disturbance will apply to all areas where roots measuring one inch in diameter or greater are likely to be encountered. When any roots one inch or greater are encountered and authorized to be cut or removed, any work shall be done under the supervision of a certified arborist and executed according to ANSI A300 standards. • Staging & Haul Route: All equipment shall be kept in designated areas as determined by the project arborist. Attention to heavy equipment's impact on remaining trees and their root protection Page 329 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 21 of 30 zones is imperative; therefore, staging shall be limited to the designated area and outside any established fencing. Ultimately, the staging location shall be agreed upon at the on-site meeting with the town-appointed consulting arborist and project arborist before the project breaks ground. Plans indicate that all material will be kept on-site, so no off-haul route designation will be necessary. Should this change, the on-site arborist shall be notified to determine the best haul route to avoid conflicts with the protected trees. • Fencing/Tree Protection Zone (TPZ): The tree protection zone has been defined by the Town of Los Gatos ordinance "Sec. 29.10.0955 – Definitions" and further described in this report as a temporary fenced area that, at a minimum, is set for a tree or group of trees under the tree's dripline, designating "…a restricted activity zone before and after construction where no soil disturbance is permitted unless approved and supervised by the certified or consulting arborist." The dripline, as defined in the same section "Sec. 29.10.0955" is the area under the canopy from the edge of the trunk that consists of the "…distance ten (10) times the diameter of the trunk, or the perimeter of the tree canopy, whichever is greater." Where possible, the TPZ fencing shall encompass as many trees in a group as possible rather than fencing individual trees. Once installed, the TPZ fencing must not be moved or altered without the authorization of the project arborist. In order to be efficient with the tree fencing, installing the TPZ fencing post tree removals would prove beneficial. This would facilitate mulch distribution under the retained tree canopies before TPZ fencing is closed off for construction. Fencing shall be entirely in place and must be inspected and approved by the project arborist or Town-appointed consulting arborist before the construction commences. Fencing shall remain in place until the project's final sign-off inspection. If work is required in the TPZ, then all work in the TPZ shall be under project arborist supervision or Town appointed consulting arborist. No vehicles or equipment, chemical substances, materials, tools, supplies, liquids, wastes, etc., will be dumped or stored within the TPZ. No attachment of wires, signs, or ropes to protected trees. All main irrigation lines shall be located outside the tree's dripline when feasible. See Appendix B for visual details. • Fencing Material for the TPZ: The contractor shall use a combination of fencing materials to provide exclusion zones. Recommended tree protection fencing shall be chain-linked and located as close to these defined locations as possible while allowing room for construction. Installation shall be as follows: Chain link fencing, a minimum of 6ft. in height, mounted on 2in diameter galvanized posts, a minimum of 8ft. long, and pounded 24in. into the ground. Spacing for tube posts must be Page 330 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 22 of 30 less than or equal to 10ft. on center. For larger extended areas, areas far enough away from the construction impact, and based on the level of impacts that may be involved with work around the trees, heavy-duty, plastic orange barrier construction fencing shall be used independently or in combination with the chain link fencing. Please refer to TP-1 through TP-6 sheets dated 07/01/25, for the details. LRCC would prefer to limit the use of chain link fencing to high-impact areas only if the orange netting is not suitable for adequate protection. The project arborist or Town consulting arborist will have final say. See Appendix B for visual details. • Locations: The TPZ are indicated on the Tree Protection map sheets (TP-1 through TP-6) associated with the HMH architectural review dated 03/28/25 has been updated as of 07/01/25. The most recent revision will be submitted to the planning department for review and to fulfill the request for more detail. Exact TPZ fence locations will be finalized prior to construction commencement. Final approval by the project arborist or Town-appointed consulting arborist will determine if TPZ fence lines require adjustment while on-site. • Trunk Protection: In areas where heavy equipment may be close to trees, or the tree protection fencing needs to be opened up for access, and the project arborist determines it, then the use of straw wattles, orange-plastic construction fencing, vertical wood slats, or a combination of the items listed can be wrapped around the tree trunk to avoid any impact damage-See Appendix B. • Signage: Affix TPZ signage to the chain link. These signs must be waterproof, 8.5in. x 11in., and recommend that they be affixed approximately once every 25-50-linear ft of TPZ fenced distance. The sign should state: "Warning – Tree Protection Zone – This fence shall not be removed and is subject to penalty according to Town Code 29.10.1025". The signs should be in English and Spanish (See samples below). ADVERTENCIA ZONA DE PROTECCIÓN DE ÁRBOLES LA BARDA NO DEBERÍA DE SER MOVIDA Ó SERÁ SUJETA A UNA MULTA DE ACUERDO CON EL CÓDIGO DE LA CIUDAD 29.10.1025 WARNING TREE POTECTION ZONE THIS FENCE SHALL NOT BE REMOVED AND IS SUBJECT TO PENALTY ACCORIDNG TO TOWN CODE 29.10.1025 Page 331 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 23 of 30 PRUNING & REMOVALS: • Pruning Standards: All required canopy or root pruning shall be performed by or under the direct supervision of an ISA-certified or ASCA-registered arborist. The pruning shall conform to the latest version of ANSI A300 Tree Care Standards for trees, shrubs, palms, and other woody landscape plants – standard practices (pruning) and the accompanying Best Management Practices– Companion publication to the ANSI A300. Before pruning commences, the contractor must call the project arborist to perform the work or meet with the assigned tree care vendor to determine the specific root, branch, or scaffold limb removal under their supervision. When temporary clearances are required, and whenever possible, low-hanging branches should be tied to hold them out of the way. If clearance is not possible by tying branches back temporarily, then the reduction of limbs must be executed by or under the supervision of an approved ISA-certified arborist. Poor pruning practices such as thinning, lions-tailing, shearing, topping, pollarding, or otherwise shall NOT be allowed as they are non-compliant with the most current specifications of ANSI-A300 standards for tree care operations. • Tree Removal Criteria Statement (Criteria per Town code 29.10.0992): As defined, a tree removal permit issued by the Town of Los Gatos is required before removing any protected-size trees. At the time of this report, it is my professional opinion that those protected trees listed for removal as part of the redevelopment of La Rinconada Golf Course are due but not limited to the following (Criteria 1, 3, 4 & 10). (Criteria 1) The trees have low overall condition ratings or poor structure that would pose a threat to the public use of the property as they are dead, dying, severely diseased, decayed, or disfigured and cannot be returned to a healthy and structurally sound condition. (Criteria 3) They may be crowding other protected trees of greater significance. (Criteria 4) The trees conflict with the proposed development and land improvements, restricting the economic enjoyment of the property. (Criteria 10) The removals and replacements will allow the property to transition towards a more native oak woodland landscape like the indigenous oak woodland and chaparral area of Los Gatos. EARTHWORK • Grading and Drainage: All changes to grade shall be outside the TPZ; even minor cut and fill processes can negatively impact trees. Changes of as little as two inches can cause a tree to decline in health and even die long-term. Cutting can fracture and damage roots, and filling can suffocate Page 332 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 24 of 30 them. It is highly recommended, where possible, that the critical root zone be protected. Therefore, wherever possible, any grade changes near the protected tree shall tie into natural grade no closer than 1.5 times (in linear feet) the tree diameter in inches when measured at 4.5ft. (54-inches) from ground level. All changes to surface drainage shall not be altered to redirect existing natural water flows into or out of the TPZ unless it is to improve the overall conditions for the tree and is specified by the arborist on-site. Therefore, the drainage improvements shall consider the natural water table levels and seasonal water distribution within the TPZ areas. For example, if water is being diverted away from a tree that has evolved on-site with that water source, then irrigation measures may need to be considered to replace this deficit and vice versa. • Soil Compaction Mitigation: Wherever possible, mulched wood chips from tree removals on site shall be utilized under the protected trees and, where necessary, inside the fenced-off areas of the Tree Protection Zone (TPZ) and any staging areas if required. This layer of mulch aids in preventing soil compaction and disruption and must be in place before construction begins. Should the contractor need access to or pass through an area of TPZ, for example, between trees, the contractor shall use a bridging technique for the ingress/egress locations. The bridge shall consist of a 4-6in. layer of mulch and 3/4in. plywood or steel road plates laid on top. • Trenching - Utilities/Drainage/Irrigation: Locations of all proposed trenching for pipes and conduits, such as storm drains, area drain boxes, gas, water, sewer, cable, electrical, and landscape irrigation lines, shall all be located outside dripline or TPZ whichever is most feasible and furthest from the trunk of the protected tree. If the offset distance from any trench is less than 15ft., from the edge of any tree trunk, contact the project arborist to consult on alignment options for optimal tree root retention. Furthermore, in cases where soil excavation for the trench is required inside the TPZ, specialized equipment such as an air spade or horizontal boring tool shall be used to protect and allow roots to be readily exposed and worked around or pruned if needed. For all digging activities near trees, the contractor shall be mindful not to do so during hot, dry weather. The root zone should be well watered before and after digging. All exposed roots shall be immediately covered with soil, mulch, or damp burlap and irrigated to ensure they do not dry out. See Appendix B for visual details. • Root Pruning: If one-inch diameter or larger roots are encountered during any site plan-related work, the project arborist shall be contacted immediately so that the soil excavation and root pruning activity can be monitored. Any areas requiring root pruning will be dug out by hand using approved Page 333 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 25 of 30 tools such as an Airspad or small hand tools to expose roots requiring pruning. Roots shall be cut at right angles to the direction of root growth, leaving clean, healthy, undamaged tissue. Furthermore, the pruning shall be done using sharp tools such as professional grade loppers, hand saws, chainsaws, Sawzall, or other appropriate instruments. Root pruning shall occur only under the direct supervision of the project arborist. Furthermore, photographs shall be taken whenever possible to document the before and after images of the pruning cuts. If damage does occur, the areas shall be hand-dug back into clear, healthy root tissue and pruned, as mentioned above. Backfill around roots immediately (same day) or cover roots with several layers (5-10) of wet burlap material to avoid root desiccation, keeping roots moist until final backfill can occur. Always backfill using existing parent soil and never compact soil around the roots. IRRIGATION: • Temporary Irrigation: If areas are to be irrigated on a temporary basis, it will be determined by the Project Arborist, who will contact appropriate site personnel to implement supplemental watering. The supplemental irrigation can be obtained via a garden hose, soaker hose, drip irrigation lines, tow-behind tank, water truck, etc., at a frequency, volume, and duration to be determined by the project arborist. Ideally, the irrigation should be applied within the TPZ and wet the top 2-3ft. of soil. With the addition of water, the General Contractor, sub, or golf course personnel shall maintain records reflecting dates of water application and application methods, volumes, and frequency. These records will be available for inspection by the project arborist as deemed necessary. Reasons for supplemental irrigation include extreme drought conditions, such as dry winters and hot summers, areas that have been routinely irrigated, and the current irrigation is being disrupted. For native species such as the oaks located in naturalized areas, it is essential to replicate as close to standard seasonal weather patterns as they are naturally accustomed to. For example, overwatering or watering too close to the trunk may create unnaturally moist soil conditions detrimental to the tree. If done excessively, over time, this may create an optimal environment for waterborne soil pathogens and harm the trees' health. • Permanent Irrigation for Tree Applications: When designing the final landscape and irrigation installation plans, watering locations and regimes should be carefully considered. Locate the irrigation lines outside of the dripline wherever possible. Completed landscape Page 334 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 26 of 30 and irrigation plan sheets were not reviewed for this initial assignment. However, it was noted that bubblers on flexible black PVC irrigation tubing will be used. If flexible irrigation tubing is also used, it should be pinned directly over grade and buried beneath mulched wood chips. The surface tubing creates an irrigation system with minimal impact on existing tree roots. The Project Arborist shall be supplied with landscape and irrigation plans for review and may recommend changes before final installation. • Tree Canopy Dust Control: To promote optimal diffusion (exchange of gases) through the openings in the leaf surfaces, and only if deemed necessary by the arborist, periodic washing of tree canopies can be performed, provided using either a standard hose on site or via a water truck, ensuring the upper and lower foliage surfaces are accessed. Periodic washing of the tree canopies will likely depend on seasonal rain or drought conditions. TREE DAMAGES, DEPOSITS, PLANTING & FINAL INSPECTION: • Damages: As required per the Town code "Sec. 29.10.1025. – Enforcement – Remedies for violations– subsection (3) Projects under construction": At a minimum, protected trees noted in this report that become damaged beyond repair due to the construction-related activity or removed without permit are subject to a replacement ratio that "…shall be at a greater ratio than that required under the standards outlined in "Table 3-1 – Tree Canopy – Replacement Standard" listed in the Town code "Sec 29.10.0985 – Determination and condition of permit". The Tree Protection Plan Checklist states, "Any protected tree on-site will require replacement according to its appraised value if it is damaged beyond repair as a result of construction." Additionally, and up to the discretion of the Town of Los Gatos, monetary fines may also be applied. • Tree Appraisal: The assessed values in the appraisal spreadsheet provided come from a combination of criteria collected during the site visit, professional experience, and formulas written by The Council of Tree and Landscape Appraisers Guide for Plant Appraisal, 10th Edition, Second Printing 2019, along with the Western Chapter International Society of Arboriculture Species Classification and Group Assignment, 2004. Trees were appraised using the "Cost Approach- Trunk Formula Technique." Formulas are derived by obtaining the basic tree cost and then applying the condition rating and additional depreciation factors, such as external and functional limitations, if appropriate. The final tree appraisal values are rounded depreciated values. For La Rinconada Country Club, that value applies only to the 732 trees listed for removal and protection in Page 335 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 27 of 30 the spreadsheets that are within proximity of the project work zone (excludes the 213 trees outside the work zone. • Tree Replacement Requirements: The replacement trees (quantity and species to be determined) are based on the criteria for replacement defined in the table below and found in Town code "Sec. 29.10.0985 Determination and conditions of permit – Table 3-1 Tree Canopy – Replacement Standard". The table below has been modified to represent non-Single-Family Residential Replacement only. Single-Family Residential Replacement details have been excluded from this document. The final determination of tree replacement will be established as part of the permit approval. Tree Canopy – Replacement Standard Canopy Size of Removed Tree1 Replacement Requirement2,4 10 feet or less Two 24-inch box trees More than 10 feet to 25 feet Three 24-inch box trees More than 25 feet to 40 feet Four 24-inch box trees or Two 36-inch box trees More than 40 feet to 55 feet Six 24-inch box trees or Three 36-inch box trees Greater than 55 feet Ten 24-inch box trees or Five 36-inch box trees "1To measure an asymmetrical canopy of a tree, the widest measurement shall be used to determine canopy size. 2Often, it is not possible to replace a single large, older tree with an equivalent tree(s). In this case, the tree may be replaced with a combination of both the Tree Canopy Replacement Standard and in- lieu payment in an amount set forth by Town Council resolution paid to the Town Tree Replacement Fund… 4Replacement Trees shall be approved by the Town Arborist and shall be of a species suited to the available planting location, proximity to structures, overhead clearances, soil type, compatibility with surrounding canopy and other relevant factors. Replacement with native species shall be strongly encouraged but is required for Hillside properties, as per section 29.10.0987, Special Provisions Hillsides, with tree species per Hillside Development Standards and Guidelines Appendix A" (Town of Los Gatos, CA Division 2. Tree Protection Ordinance 2022). • Final Inspection: A final inspection by the Town Arborist at the end of the project is mandatory to ensure all tree replacements have been made. It is recommended that tree planting occur at the end of the project upgrades or when the time comes to implement the landscaping phase to ensure their establishment's success and avoid unnecessary damage. Page 336 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 28 of 30 ADDENDUM TO LRCC TREE REPORT FOR THE GOLF COURSE MODERNIZATION PROJECT 07/01/2025 PURPOSE: Recommendation for removing forty-seven additional trees and justification for using a polyvinyl tree protection fence. Per the request of the Town of Los Gatos, I have adjusted the tree protection inventory spreadsheets to include the extra trees proposed for removal based on their overall conditions relating to being potentially hazardous, located in high target areas, actively failing, in the process of dying, or not suitable for their current environment. I have noted these trees with an HR to represent Hazard Removal. These additional trees have been included throughout the revised documents dated 07/01/25. They are reflected in the inventory spreadsheet as HR, to represent Hazard Removal, and included in the representative graphs as a part of this updated report (e.g., calculation for the replacement trees and native vs. non-native species). Furthermore, they have been added to the Architectural and Site Review Plans with a designated symbol to distinguish from the previous removals requested. Below are the tree species count, botanical and common names, and associated tree tag numbers. Please refer to the accompanying inventory spreadsheet for details. ADDITIONAL 47x TREE REMOVAL RECOMMENDATION: 1x –Araucaria heterophylla (Norfolk Island pine)- Tree No. 644 1x -Casurina sp. (Casurina)- Tree No. 102 1x -Cupressus arizonica (Arizona cypress)- Tree No. 687 12x -Eucalyptus camaldulensis (river red gum)- Tree No. 48, 51, 72, 76, 82, 85, 535, 537, 539, 552, 739, & 925 17x -Fraxinus excelsior (European ash)- Tree No. 633, 642, 643, 645, 646, 647, 648, 650, 652, 657, 658, 659, 660, 661, 662, 663 & 666 5x -Fraxinus uhdei (Shamel ash)- Tree No. 398, 686, 689, 690, & 691 6x -Fraxinus velutina (Modesto ash)- Tree No. 300, 429, 430, 490, 620, & 667 1x -Olea europaea (olive)- Tree No. 511 2x -Quercus agrifolia (coast live oak)- Tree No. 104 & 624 1x -Quercus douglasii (blue oak)- Tree No. 471 Page 337 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 29 of 30 JUSTIFICATION FOR CHANGE IN FENCING MATERIAL USED ON-SITE: Tree Protection maps dated 7/01/25 have been revised to reflect the approximate fencing locations and materials to use. We have provided consultation on the fencing locations and materials, and post review, feel that the location of the orange-colored high-density polyethylene fencing with 3.5in. x 1.5in. openings in the locations suggested on the map are sufficient. The decisions were based on reviewing the plans and work to be done in and around the areas of the trees. The level of proposed impact (none, low, moderate, and high) was noted and used to make the abovementioned decisions. We recommend using alternative fencing materials in low-to-no-impact areas and a combination of high-visibility plastic and metal chain link fencing in areas with predicted moderate impacts. All areas of potential high impact shall have the chain link fencing installed, as previously noted in the report provided and dated April 25th, 2025. Due to the scope of the project, with a large number of trees and areas to be fenced, along with the proposed goals to retain as many trees as possible, the use of the orange fencing will aid in making sure the project is executed to meet these goals. The reduction in cost for the material and for the workforce to install and move metal fencing can be transferred to more physical on-site presence of an arborist or appointed staff to ensure that ALL areas are being restricted from unnecessary access and ensuring tree protection. The orange fencing will also allow for the convenience of shifting from area to area as the project moves along, as construction will be performed in phases, and access to critical areas that may require supervised work by hand can be more effectively managed. Finally, the bright color will also improve visibility. Page 338 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 30 of 30 FINAL STATEMENT Should you have any questions regarding the above information, please do not hesitate to call us. Thank you, Lisa Edwards Straun Edwards ISA Certified Arborist WE-5612A ISA Certified Arborist WE-5055A 408-455-5911 408-898-0625 ❖ This report or at a minimum the Protection Requirements and Protections Measures section within this report is to be copied onto a plan sheet and become part of the final plan set. The owner, contractor, and architect are all responsible for knowing the information included in the arborist report and adhering to the conditions provided. ❖ The arborist report, once copied onto a plan sheet and included in the final set of plans, along with the Sec. 29.10.1005-Protection of trees during construction serves as a Tree Preservation Plan. ❖ Retain the services of a certified or consulting arborist who shall serve as the project arborist for periodic monitoring of the health of the trees to be preserved. The project arborist will be present whenever activities occur which may pose a potential threat to the health of the tree to be preserved and shall document all site visits. ❖ Trees requested for removal must meet the tree removal criteria, and qualify for removal and replacement as part of the project. Sec. 29.10.0992-Required Findings. No trees shall be removed without permits. ❖ Contractor shall ensure that construction activity is set back far enough from trees to provide adequate protection, unless otherwise noted, with mitigation and protection measures required to provide adequate protection. ❖ The director and project arborist shall be notified of any damage that occurs to a protected tree during construction so that proper treatment may be administered. ❖ Any tree on site protected by Town code Sec. 29.10.0960 that is damaged during any phase of the project will require replacement according to its appraised value if it is damaged beyond repair because of construction. Sec. 29.10.1025-Enforcement – Remedies for violation ❖ The TPZ fencing shall remain in place until the project has been completed, inspected, and approved for removal by the Town Arborist. Page 339 La Rinconada Country Club 14595 Clearview Dr. Los Gatos, Ca. 95032 Page 31 of 30 BIBLIOGRAPHY American National Standards for Tree Care Operations. "Management of Trees and Shrubs during Site Development and Construction/Part 9." ANSI A300 Tree Care Standards for Trees, Shrubs, Palms, and Other Woody Landscape Plants, Tree Care Industry Association, Inc., Manchester, NH, 2023. American National Standards for Tree Care Operations. "Pruning/Part 5." ANSI A300 Tree Care Standards for Trees, Shrubs, Palms, and Other Woody Landscape Plants, Tree Care Industry Association, Inc., Manchester, NH, 2023. American National Standards for Tree Care Operations. "Root Management/Part 12." ANSI A300 Tree Care Standards for Trees, Shrubs, Palms, and Other Woody Landscape Plants, Tree Care Industry Association, Inc., Manchester, NH, 2023. Council of Tree and Landscape Appraisers. Guide for Plant Appraisal. 10th ed., International Society of Arboriculture, 2019. Hagen, Bruce W., et al. Oaks in the Urban Landscape: Selection, Care, and Preservation. University of California. Agriculture and Natural Resources, 2011. ISA. Species Classification and Group Assignment, Western Chapter Regional Supplement. Western Chapter, International Society of Arboriculture, 2004. Johnson, Jill R., et al. Tree Owner's Manual. U.S. Dept. of Agriculture, Forest Service, Northeastern Area, State and Private Forestry, 2010. Lilly, Sharon, et al. Pruning Best Management Practices. 3rd ed., International Society of Arboriculture, 2019. Matheny, Nelda, and James R. Clark. Trees and Development: A Technical Guide to Preservation of Trees During Land Development. International Society of Arboriculture, 1998. Town of Los Gatos, CA Division 2. Tree Protection Ordinance 2015-2022 Page 340 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected Tree1 37.00 na na Sequoia sempervirens coast redwood 50/30 85/80/75 75%-Good Protected Moderate Retain $30,557.76 2 32.50 na na Sequoia sempervirens coast redwood 50/30 85/80/75 75%-Good Protected Moderate Retain $23,576.79 3 37.00 na na Quercus agrifolia coast live oak 35/40 80/50/60 50%-Fair Large Protected Moderate Retain $25,465.77 4 37.50 na na Sequoia sempervirens coast redwood 50/30 55/30/65 30%-Poor Protected Moderate Retain $12,555.69 5 28.50 na na Sequoia sempervirens coast redwood 45/30 60/90/80 60%-Fair Protected Moderate Retain $14,504.33 6 26.00 na na Sequoia sempervirens coast redwood 40/25 65/90/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $10,059.43 7 26.50 na na Casurina sp.Casurina 40/35 85/50/50 50%-Fair Photo Protected Moderate Remove 4, 10 (4X) 24-in. or (2x) 36-in. $16,328.83 8 39.00 na na Sequoia sempervirens coast redwood 50/20 75/75/75 75%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $33,950.58 9 30.50 na na Sequoia sempervirens coast redwood 60/20 75/50/60 50%-Fair Photo Protected Moderate Remove 4, 10 (3x)24-in.$15,380.98 10 42.00 na na Sequoia sempervirens coast redwood 60/25 80/80/80 80%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in.$46,666.24 11 35.00 na na Quercus lobata valley oak 30/60 70/20/50 20%-Very Poor Large Protected None Retain $21,476.33 12 48.00 na na Quercus lobata valley oak 40/65 80/80/65 65%-Good Large Protected None Retain $131,277.36 13 22.00 22.00 44.00 Quercus douglasii blue oak 40/35 85/85/85 85%-Excellent Protected None Retain $72,125.41 14 28.50 na na Quercus douglasii blue oak 30/40 60/60/60 60%-Fair Large Protected None Retain $21,360.18 15 37.50 na na Sequoia sempervirens coast redwood 60/25 80/80/60 60%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $27,901.53 16 41.00 na na Quercus lobata valley oak 35/30 80/45/80 45%-Fair Large Protected High Retain $66,309.27 Notes Tree is next to #1 Tee and cart path, behind clubhouse. Overall condition, typical for species. Some small branch failures in upper 1/3 of canopy on east side. Minor deadwood and small broken branches throughout. Generally healthy, low squat form tree that was recently pruned within the last year to reduce heavy end weight and provide clearance between cart path and #1 fairway. Codominant and included at 3ft. Frass noted at base of the tree, indicative of borer activity. Thin canopy overall, multiple codominant unions in upper canopy with included bark. Tree canopy foliage is thin. Form and structure typical for species. Large sprawling tree, mature specimen on east slope between back of residence and #1 fairway. Form is compromised by previously adjacent, large canopy trees of similar species, now both neighboring trees are dead. Codominant at 5ft. with good union. Majority of growth to the southwest leaving canopy sparse, typical for species of age and stature. Codominant at 3.5ft good looking tree, typical for species in naturalized environment. Asymmetrical form. Height has been maintained under powerlines. Ivy growing at base, recommend removal. Canopy has some significant size deadwood, structure is compromised due to location, under powerlines. Typical for species, minor co-dominance at top. Water damage to trunk from impact sprinkler. The tree canopy has been raised up to 30ft. to provide clearance. Tree appears aesthetically good, it is located in the center of the fairway. Tree has been pruned to maintain canopy for clearanceson. Overall structure has been compromised due to failure of central leader several decades ago. Tree canopy thin on east side, overall good tree. Structure is typical for species. Relatively small tree for species, asymmetrical form. Form and structure condition rating are both fair overall. Thin canopy, form compromised by adjacent tree limited growing space. Swelling and decayed area at trunk base (decay on south side), where previous trunk failure occurred. Photo link shows adjacent tree directly behind it. Major defect at top of tree, codominant with inclusion at approximately 40ft. Form is compromised by adjacent tree, limited growing space. Good tree that has grown and developed a lean then self corrected its form. Overall, tree is good. Valley oak located in rough off #1 fairway. Large central leader failed and top has regrown. Canopy has been pruned to clean up past failures. Codominant union between 4-5ft. Wood pecker holes/cavities throughout. Structure compromised by main leader tear out. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 341 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 17 51.00 na na Sequoia sempervirens coast redwood 70/35 80/60/80 60%-Fair Large Protected Moderate Retain $46,446.01 18 31.50 na na Sequoia sempervirens coast redwood 50/20 30/85/85 30%-Poor Protected Moderate Retain $8,859.29 19 26.00 na na Sequoia sempervirens coast redwood 40/25 50/85/85 50%-Fair Photo Protected Moderate Remove 4, 10 (3x)24-in. $11,177.15 20 30.00 na na Sequoia sempervirens coast redwood 40/30 45/85/85 45%-Fair Protected Moderate Retain $13,392.74 21 18.50 na na Sequoia sempervirens coast redwood 35/25 50/85/85 50%-Fair Protected Moderate Retain $5,092.96 22 28.00 na na Sequoia sempervirens coast redwood 50/25 75/85/85 75%-Good Protected High Retain $15,555.41 23 28.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $17,499.84 24 26.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Protected High Retain $15,089.15 25 28.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in.$17,499.84 26 31.50 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Protected High Retain $22,148.24 27 34.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $25,803.34 28 34.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $25,803.34 29 26.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $15,089.15 30 34.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $25,803.34 31 37.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $30,557.76 32 37.00 na na Sequoia sempervirens coast redwood 50/25 75/90/85 75%-Good Protected Moderate Retain $30,557.76 Structure has self corrected with time. Canopy is thin with epicormic sprouts throughout; tree appears stressed. Structure is typical for species. Similar to other redwoods on the course, there is visible trunk damage from impact sprinkler irrigation and golf balls. Similar to tree no. 19 with small amounts of dead foliage throughout the canopy. Young tree with typical form and structure for species. Tree has irrigation damage to the trunk on west side. Other than that typical for species. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Good overall health, foliage vigor appears normal. Tree is codominant with included bark in upper canopy at approximately 50ft. Structure is a limiting factor that could be corrected with pruning over several years. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, edge of #1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as a screen. Powerlines run through the lower canopies of trees no. 31- 32. affecting canopy of no. 32 more than 31. Clearance pruned. Trees 23-34 include a stand of trees that line the cart path, edge of #1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as a screen. Powerlines run through the lower canopies of trees no. 31- 32. affecting canopy of no. 32 more than 31. Clearance pruned. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 342 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 33 39.00 na na Sequoia sempervirens coast redwood 50/25 75/85/85 75%-Good Protected Moderate Retain $33,950.58 34 35.00 na na Sequoia sempervirens coast redwood 50/25 75/85/85 75%-Good Protected Moderate Retain $27,343.50 35 15.50 17.00 32.50 Eucalyptus sp.Eucalyptus 30/40 75/60/60 60%-Fair Protected Low Retain $27,835.95 36 16.50 17.50 34.00 Eucalyptus sp.Eucalyptus 35/30 75/50/75 50%-Fair Protected Low Retain $25,355.22 37 21.50 14.50 36.00 Eucalyptus sp.Eucalyptus 35/30 80/50/50 50%-Fair Protected Low Retain $29,475.17 38 14.00 na na Eucalyptus sp.Eucalyptus 20/20 80/70/50 50%-Fair Protected Low Retain $8,590.53 39 24.00 na na Eucalyptus sp.Eucalyptus 35/30 70/20/40 20%-Very Poor Protected Low Retain $10,098.26 40 40.00 19.50 49.50 Eucalyptus sp.Eucalyptus 50/25 60/50/50 50%-Fair Large Protected Low Retain $86,792.87 41 28.00 20.00 48.00 Eucalyptus sideroxylon red ironbark 35/30 40/40/60 40%-Poor Photo Large Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$33,212.05 42 23.00 24.00 47.00 Salix laevigata red willow 30/45 50/40/45 40%-Poor Protected Low Retain $7,308.13 43 26.00 na na Eucalyptus camaldulensis river red gum 40/30 70/55/45 45%-Fair Protected Low Retain $7,859.23 44 48.00 15.00 63.00 Eucalyptus camaldulensis river red gum 60/50 80/75/70 70%-Good Large Protected Low Retain $45,737.00 45 11.50 na na Eucalyptus camaldulensis river red gum 35/10 80/85/80 80%-Good Exempt Moderate Retain $2,733.42 46 13.50 na na Eucalyptus camaldulensis river red gum 35/10 80/50/50 50%-Fair Exempt Moderate Retain $2,354.28 47 14.00 na na Eucalyptus camaldulensis river red gum 35/10 80/80/80 80%-Good Exempt Moderate Retain $4,051.04 48 31.00 na na Eucalyptus camaldulensis river red gum 45/30 20/10/10 10%-Very Poor Photo Protected Moderate HR 1 (4X) 24-in. or (2x) 36-in.$2,482.81 Tree no. 35-40 are all Eucalyptus trees, possibly E. microtheca (Coolibah)-are growing together in a mulched greenbelt area at the top of a knoll between #1 fairway and driving range. This tree is codominant at 2ft., has minor deadwood and evidence of past lateral limb failures in the upper canopy. Tree no. 35-40 are all Eucalyptus trees, possibly E. microtheca (Coolibah)-are growing together in a mulched greenbelt area at the top of a knoll between #1 fairway and driving range. This tree has an asymmetrical, twisted form and a large amount of epicormic sprouts. Codominant with included bark at 15ft. Tree no. 35-40 are all Eucalyptus trees, possibly E. microtheca (Coolibah)-are growing together in a mulched greenbelt area at the top of a knoll between #1 fairway and driving range. The form is compromised by adjacent tree no. 37, which is leaning into it. Tree has been pruned over time to maintain clearances over course. Tree no. 35-40 are all Eucalyptus trees, possibly E. microtheca (Coolibah)-are growing together in a mulched greenbelt area at the top of a knoll between #1 fairway and driving range. Structure is codominant at 5ft. with secondary trunk removed between 4-5ft., overall form is asymmetrical. Branch failures are noted throughout, including at base on west side where decay is visible. Tree no. 35-40 are all Eucalyptus trees, possibly E. microtheca (Coolibah)-are growing together in a mulched greenbelt area at the top of a knoll between #1 fairway and driving range. Structure is twisted with depressions throughout the trunk bark surface. Appears to be reaction wood response to canker or some other unknown factor. Structure is codominant from 2.5-3ft., with multiple trunks and lower lateral limbs removed. Dieback is apparent in upper canopy. Overall structure is poor which is typical for species. High amount of sucker growth makes up majority of canopy foliage. Trees 23-34 include a stand of trees that line the cart path, at edge of # 1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Trees 23-34 include a stand of trees that line the cart path, edge of #1 fairway. These trees are in good overall condition. The ground has been maintained with mulch over the years. The trees are good for the intended use as screen. Minor tip codominance that could be corrected with pruning. Tree no. 35-40 are all Eucalyptus trees, possibly E. microtheca (Coolibah)-are growing together in a mulched greenbelt area at the top of a knoll between #1 fairway and driving range. This tree has a codominant structure from base, minor deadwood. The form is typical of species. Recommend removal, codominant with decay in union from base on north side. It is included from 0 to 10ft., leans over the road and golf course. Hazardous This is a large sprawling tree located along fenceline of Wedgewood Ave. Structure is codominant from base, the form consists of a twisted canopy that has been pruned over overtime to maintain clearances. This is a large tree close to fenceline of Wedgewood Ave. The tree grows out towards the road searching for space and light, due to competition with larger adjacent trees. This is a large tree typical for species. Good overall condition. Trees no. 45-47 are all young, typical for species growing next to fencelineof Wedgewood Ave. Sap sucker damage to trunk. Tree is under the size requirement for removal permit. Trees no. 45-47 are all young, typical for species growing next to fencelineof Wedgewood Ave. Sap sucker damage to trunk. Tree is under the size requirement for removal permit. Trees no. 45-47 are all young, typical for species growing next to fencelineof Wedgewood Ave. Tree is under the size requirement for removal permit. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 343 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 49 8.00 6.00 14.00 Eucalyptus camaldulensis river red gum 30/10 60/20/20 20%-Very Poor Exempt Moderate Retain $516.71 50 14.00 na na Eucalyptus camaldulensis river red gum 40/15 50/20/30 20%-Very Poor Exempt Low Retain $1,012.76 51 16.50 na na Eucalyptus camaldulensis river red gum 40/20 30/6/6 6%-Very Poor Photo Exempt Moderate HR 1 (3x)24-in. $202.57 52 25.00 na na Sequoia sempervirens coast redwood 65/30 41/85/60 41%-Fair Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$7,626.42 53 16.50 na na Cupressus arizonica Arizona cypress 12/20 30/30/30 30%-Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $6,443.56 54 25.00 na na Eucalyptus camaldulensis river red gum 60/30 80/80/80 80%-Good Protected Moderate Retain $23,252.16 55 26.00 na na Eucalyptus camaldulensis river red gum 55/15 80/70/60 60%-Fair Protected Low Retain $18,862.15 56 15.50 na na Eucalyptus camaldulensis river red gum 45/20 30/40/40 30%-Poor Exempt Low Retain $3,351.80 57 16.00 na na Eucalyptus camaldulensis river red gum 50/15 70/70/60 60%-Fair Exempt Moderate Retain $6,349.39 58 18.00 na na Eucalyptus camaldulensis river red gum 30/10 50/06/45 06%-Very Poor Exempt Moderate Retain $803.59 59 15.50 na na Pyrus calleryana Callery pear 25/20 10/06/10 06%-Very Poor Protected Low Retain $1,263.60 60 23.50 na na Eucalyptus camaldulensis river red gum 50/30 70/40/70 40%-Poor Exempt Low Retain $10,272.80 61 25.00 22 & 17 64.00 Eucalyptus camaldulensis river red gum 50/50 60/20/70 20%-Very Poor Photo Large Protected High Remove 1, 4, 10 (6x)24-in. or (3x)36-in.$13,002.61 62 25.50 na na Sequoia sempervirens coast redwood 55/20 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $19,352.50 63 26.00 na na Eucalyptus camaldulensis river red gum 50/25 50/20/40 20%-Very Poor Protected Low Retain $6,287.38 64 13.00 na na Eucalyptus camaldulensis river red gum 50/20 50/30/30 30%-Poor Exempt Low Retain $2,357.77 Tree is typical for species. Recommend pruning to remove deadwood and reduce heavy end-weight. Tree grows on a slight lean due to competition with adjacent trees. Tree grows on a lean out from under trees with larger canopies. There is evidence of large lateral limb failures. Tree appears to be typical for species growing in a grove. Tree has a large decay pocket at base on the south side, as well as in upper part of the canopy and main leader. It grows next to and out from under tree #55. Large amount of deadwood- overall poor specimen. Tree is under the size requirement for removal permit. Structure is codominant at 10ft., with a good union. Tree grows out from under canopies of #54 and #55. Significant lean to south west due to competition. Tree is under the size requirement for removal permit. Structure has been compromised-Large amount of sucker growth throughout canopy. All main branches and leaders have failures. Tree is under the size requirement for removal permit. Tree appears to be in severe decline. Structure is poor and form is compromised. Visually, this is an aesthetically unappealing tree. Young tree, appears to be a volunteer, with twin trunk from ground level. This tree is codominant and has no long-term future, as it grows on a lean at fenceline.Tree is under the size requirement for removal permit. Structure is compromised by past failure of central leader. Other failures also visible throughout remaining canopy. Tree is under the size requirement for removal permit. This tree grows on a heavy lean over Wedgewood Ave. and powerlines. Large amount of decay at base of the tree-recommend removal. Hazardous-Tree is under the size requirement for removal permit. This tree appears to be stressed with some decline apparent towards the bottom half of the tree (on cart path side). Small size tree at edge of cart path that has been pruned for clearance. Major lateral limb failures evident. Large tree with evidence of a second trunk failure at base on Southwest side. There are significant dead limbs and failed scaffold branch throughout, consider pruning to improve. Tree is under the size requirement for removal permit. This is a large sprawling tree with three trunks, long-term failure is imminent. Structure is codominant with included bark and cracks, as well as, bulging reaction wood. Past branch failures are apparent in the upper canopy. The tree could be pruned to reduce heavy end-weight if whole tree is not removed. Overall condition is good and typical for species. It is a good looking tree growing on its own. Large tree with significant wounds from lateral limb failures on north side of the trunk. The tree grows on a lean, from a point of failure, to the west and south side. Canopy has large size deadwood throughout. Tree consists of the remaining half of what was once a twin trunk tree. The second leader was removed or failed and what is left grows on a lean to the west -mostly due to competition from larger surrounding trees. Tree is under the size requirement for removal permit. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 344 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 65 24.00 na na Eucalyptus camaldulensis river red gum 50/20 40/06/40 06%-Very Poor Large Protected Low Retain $1,607.19 66 26.00 22.00 48.00 Eucalyptus camaldulensis river red gum 50/40 70/20/60 20%-Very Poor Large Protected Low Retain $10,789.00 67 13.80 na na Eucalyptus camaldulensis river red gum 45/15 50/30/50 30%-Poor Exempt Low Retain $2,656.88 68 14.00 na na Eucalyptus camaldulensis river red gum 35/25 70/40/60 40%-Fair Exempt Low Retain $3,645.94 69 17.80 16.20 34.00 Eucalyptus camaldulensis river red gum 50/20 80/50/60 50%-Fair Protected Low Retain $13,469.51 70 10.00 10.00 20.00 Eucalyptus camaldulensis river red gum 40/15 65/30/40 30%-Poor Exempt Low Retain $2,790.26 71 14.50 na na Eucalyptus camaldulensis river red gum 50/15 50/50/50 50%-Poor Exempt Low Retain $4,888.77 72 13.20 na na Eucalyptus camaldulensis river red gum 50/25 06/06/06 06%-Very Poor Photo Exempt Low HR 1 (3x)24-in. $486.17 73 11.00 14.00 25.00 Eucalyptus camaldulensis river red gum 45/20 60/40/40 40%-Poor Protected Low Retain $5,896.75 74 15.00 11,10, & 10 46.00 Eucalyptus camaldulensis river red gum 50/30 50/10/50 10%-Very Poor Protected Low Retain $2,636.79 75 23.50 18 & 15 56.50 Eucalyptus camaldulensis river red gum 60/45 65/50/70 50%-Fair Large Protected Low Retain $25,606.44 76 19.00 na na Eucalyptus camaldulensis river red gum 30/50 70/20/10 10%-Very Poor Photo Exempt Moderate HR 1 (6x)24-in. or (3x)36-in.$1,678.81 77 20.50 na na Eucalyptus camaldulensis river red gum 25/25 50/6/10 6%-Poor Exempt Low Retain $1,172.61 78 37.50 na na Eucalyptus camaldulensis river red gum 55/40 40/20/50 20%-Very Poor Protected Low Retain $13,079.34 79 17.00 12.00 29.00 Rhus lancea African sumac 20/25 50/20/45 20%-Very Poor Protected Low Retain $7,591.23 80 45.00 na na Eucalyptus camaldulensis river red gum 60/50 60/20/50 20%-Very Poor Protected Low Retain $18,834.25 This tree is 99% dead, recommend removal. Tree is under the size requirement for removal permit. Canopy is dense with codominant branch structure throughout. Overall form is inhibited by adjacent, larger canopy trees. Visible sap sucker damage to bark. This tree has poor structure with multiple trunks. The tree will eventually push itself apart. Limited growth space for all four trunks. Consider long term removal This tree is formed by large cluster of three trunks, from ground level with no inclusions. Small trunk on Southwest side has the heaviest lean. The base of trunk appears to have concrete and soil built up. Failures are likely to occur in future if left alone. Tree grows with a heavy lean to the west, soil appears fractured on the backside of the lean and there are horizontal stress cracks visible on the trunk. Tree likely to fail if left alone. Recommend removal. Tree is under the size requirement for removal permit. Top of tree has recently failed at 15ft., leaving canopy to exist as sucker growth only. Consider habitat tree if left alone. Tree is under the size requirement for removal permit. Once a triple trunked tree is now a twin leader tree. The third trunk was removed at the union where the two remain. Grass is now growing in the center of the union, indicative of soil and moisture buildup. There is evidence of large branch failures throughout. Highly recommend pruning for end weight to reduce chance of future failures. Small in stature, significant size deadwood in the canopy. Canopy consists of multiple codomint union with evidence of decay were large scaffold limbs have failed. Poor structure overall. Tree is under the size requirement for removal permit. Small stature tree with large cavity from secondary trunk failure on the north side at the base. Large size lateral limb failures are visible. Overall form is fair, recommend pruning to improve. Tree is under the size requirement for removal permit. Twin trunk tree with a secondary leader failure at 12ft., leaving canopy form asymmetrical. Codominant from base with included bark, and grows on a lean to the northwest. The trees future is limited, and likely to fail. Consider removal. Tree is under the size requirement for removal permit. Thin form with past lateral limb failures, appears to be in heavy competition with adjacent trees. Canopy is very sparse. Tree is under the size requirement for removal permit. Twin trunk tree with included bark from ground level. The third trunk already failed, highly recommend removal long-term as this tree has a limited future and is likely to fail. This is a twin trunk tree that was once a triple trunk tree. The third leader was removed at 1-2ft. Codominant union with included bark. Visible evidence of large scaffold, branch failures, and deadwood throughout canopy. Small stature tree- typical for species. There is a large amount of sapsucker damage to the bark and branches throughout. Large amount of decay and deadwood. Foliage consists primarily of epicormic sprouts. Large tree with significant amounts of decay setting in from ground level to 15ft. on the southwest side. Three large scaffold limbs have been shed in upper canopy, on the west side. Significant size deadwood throughout with asymmetrical form, mainly due to failures. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 345 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 81 43.00 na na Eucalyptus camaldulensis river red gum 50/40 90/60/80 60%-Fair Protected Moderate Retain $51,591.89 82 9.00 na na Eucalyptus camaldulensis river red gum 30/10 80/80/60 60%-Fair Photo Exempt Moderate HR 1 (2x)24-in. $1,255.62 83 8.50 na na Eucalyptus camaldulensis river red gum 30/10 85/80/85 80%-Fair Exempt Moderate Retain $1,493.31 84 13.50 7.00 20.50 Eucalyptus camaldulensis river red gum 35/15 85/50/70 50%-Fair Exempt Moderate Retain $2,987.26 85 20.00 na na Eucalyptus camaldulensis river red gum 55/25 85/80/70 70%-Good Photo Exempt Moderate HR 1 (3x)24-in. $7,234.01 86 15.00 na na Acacia dealbata silver wattle 40/20 70/85/80 70%-Good Protected Low Retain $3,906.21 87 8.00 14.00 22.00 Quercus ilex Holly oak 30/20 30/50/40 30%-Poor Protected Moderate Retain $5,469.89 88 27.00 na na Acacia dealbata silver wattle 50/30 40/10/50 10%-Very Poor Protected Moderate Retain $813.83 89 15.00 na na Eucalyptus camaldulensis river red gum 30/30 60/80/50 50%-Fair Exempt Moderate Retain $9,040.10 90 8.00 8,6,6,6, & 4 38.00 Acacia dealbata silver wattle 25/25 70/20/50 20%-Very Poor Protected Low Retain $1,249.99 91 12.00 na na Casurina sp.Casurina 20/10 90/90/40 40%-Poor Photo Protected High Remove 1, 4, 10 (2x) 24-in. $2,678.65 92 22.50 na na Casurina sp.Casurina 40/30 90/90/90 90%-Excellent Protected Moderate Retain $21,188.53 93 20.00 na na Casurina sp.Casurina 45/20 80/50/40 40%-Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $7,440.69 94 13.50 na na Casurina sp.Casurina 25/10 10/10/10 10%-Very Poor Protected Moderate Retain $847.54 95 20.00 na na Sequoia sempervirens coast redwood 50/15 10/70/10 10%-Very Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $1,190.47 96 31.50 na na Sequoia sempervirens coast redwood 50/30 21/80/70 21%-Poor Protected High Retain $6,201.51 Consists of a cluster of volunteer sprouts growing adjacent to chain-link fencelinealong Wedgewood Ave. Growing space 6in. from cart path-competing for canopy space, poor form and visually unappealing. Growing 2in. from cart path Growing 6in. from cart path. Poor overall form and structure. Poor overall condition, dead central leader. Tree appears to be in severe decline-dying. Tree appears to be a stump sprout or volunteer. Structure is compromised from base where two trunks emerge. The smaller of the two trunks grows through the chain-link fence, consider removal. Tree is under the size requirement for removal permit. Healthy young tree that is growing with a chain-link fence embedded between 1-6ft. Large stem grows over the road -Recommend removal. Tree is under the size requirement for removal permit. This tree also has chain-link fence embedded at base of trunk. The upper canopy becomes codominant with a good union. Overall condition is good, typical for species, unfortunately, growing in poor location. Codominant with a good union at 2ft. Tree has been pruned for cart path clearance. Bark is riddled with sapsucker damage. Overall, the form and structure are poor due to competition from adjacent, larger canopy trees, causing canopy of this particular tree to be sparse. Poor health and structure. This was once a twin trunk tree from ground level. The second leader has previously failed at base. Stump still intact and exists between tree no. 88-89. There are codominant unions with included bark in the upper canopy-which also appears to be dying back. Large asymmetrical canopy, tree grows out from beneath larger canopies of adjacent trees. All growth is to the west searching for light. Tree is under the size requirement for removal permit. Large tree in good health that has been pruned for weight reduction over the years. The tree also lost a couple of large scaffold limbs. Needs to be maintain due to sheer size -Very Large. Noted decay pocket on trunk (northeast side) and trunk wounds from continuously being hit by golf balls. Young volunteer growing beside chain-link fence. Recommend removal-long-term future compromised. Tree is under the size requirement for removal permit. Young volunteer, straight trunk tree growing 3- 4ft. from chain-link fence along Wedgewood Ave. Overall good young specimen, tree is typical for species. Tree is under the size requirement for removal permit. Tree appears to be in decline, highly stressed with evidence of branch die back throughout canopy and large amount of sucker growth at base. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 346 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 97 15.00 na na Sequoia sempervirens coast redwood 45/15 50/90/90 50%-Fair Protected High Retain $3,348.18 98 21.00 na na Sequoia sempervirens coast redwood 50/20 45/90/90 45%-Fair Protected High Retain $5,906.20 99 20.00 na na Sequoia sempervirens coast redwood 50/15 30/80/80 30%-Poor Protected High Retain $2,380.93 100 25.00 na na Sequoia sempervirens coast redwood 50/25 50/75/80 50%-Fair Protected High Retain $6,200.34 101 34.00 na na Sequoia sempervirens coast redwood 50/20 70/90/80 70%-Good Protected High Retain $26,759.02 102 22.40 na na Casurina sp.Casurina 45/20 30/10/10 10%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $1,296.33 103 19.00 na na Fraxinus oxycarpa Raywood ash 30/30 70/70/70 70%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$13,290.78 104 21.00 na na Quercus agrifolia coast live oak 30/45 40/20/60 20%-Very Poor Photo Protected High HR 1 (6x)24-in. or (3x)36-in.$4,557.42 105 19.00 na na Cedrus deodara Deodar cedar 45/25 75/80/61 61%-Good Photo Protected High Remove 4, 10 (3x)24-in. $11,378.57 106 19.00 na na Cedrus deodara Deodar cedar 45/30 75/80/61 61%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$11,378.57 107 40.00 na na Sequoia sempervirens coast redwood 50/30 70/60/90 60%-Fair Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$31,745.74 108 32.00 na na Sequoia sempervirens coast redwood 50/25 70/70/70 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $23,703.49 109 24.00 na na Quercus agrifolia coast live oak 30/25 70/40/60 40%-Poor Large Protected High Retain $10,714.60 110 12.50 na na Quercus agrifolia coast live oak 25/15 65/20/45 20%-Very Poor Protected Moderate Retain $1,453.26 111 17.00 na na Eucalyptus sideroxylon red ironbark 256/15 70/40/30 30%-Poor Protected Moderate Retain $5,319.99 112 10.00 na na Quercus agrifolia coast live oak 15/15 70/50/50 50%-Fair Protected Moderate Retain $2,066.86 Tree has codominant top and minor deadwood- could be corrected with pruning. Noted irrigation damage to the trunk bark. Located behind #3 Tee (between Tee and chain-link fence on Wedgewood Ave.). Multiple scaffold limbs with codominant union and included bark starting at 5ft. Canopy is vase shaped and upright with a visible bark seem below the union (appears to be cracking). Overall form has been compromised by extensive clearance pruning. There is evidence of sapsucker damage to the bark. Small tree on a slope, bird box installed on trunk, accumulated debris at the base. Crack appears to be forming above the box. Healthy tree. Poor structure with included unions which typical for the species. Provides significant amount of screening in this corner of the course, near Wedgewood Ave. Should tree fail, impact will be minimal. Small volunteer, understory tree competing for light and space under larger eucalyptus. Tree has poor structure with recent branch failure over the cart path. Canopy is codomint with included bark between the union at 25ft. Canopy has a large amount of epicormic growth. Crack with decay from 1-15ft. on the west side of trunk. Majority of tree leans over the road and sidewalk. Deemed hazardous-recommend removal. Tree is currently deciduous, overall condition appears to be good at time of inspection. Updated photo taken in Spring of 2025. Tree is currently in process of splitting in half, staining on the trunk, canopy is thin and sparse. Hazardous- recommend removal. Tree is small in stature, form is asymmetrical, and canopy has been pruned to maintain clearance. Minor amount of deadwood and evidence of a broken limb. Tree grows on a lean and is very asymmetrical in form-minor deadwood . Top of tree has been failed and regrown, leaving a top with multiple leaders at 15ft. Longterm problem-Recommend pruning or removal. Trees no. 97 -99 are all three growing in a grove, along side of cart path and #2 rough. Trees no. 97 -99 are all three growing in a grove, along side of cart path and #2 rough. Trees no. 97 -99 are all growing in a grove, along side cart path and #2 rough. Tree appears to be dying. Tree has small codominant leader that can be corrected with pruning. Overall condition is typical for species. Visually, this tree appears to be the best of the group. Minor form deviation as it is slightly compromised by adjacent tree no. 100. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 347 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 113 17.00 na na Eucalyptus sp.Eucalyptus 40/30 80/50/65 50%-Fair Protected Moderate Retain $12,666.65 114 25.00 10.00 35.00 Eucalyptus sideroxylon red ironbark 45/30 70/15/25 15%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$7,626.29 115 23.00 na na Eucalyptus sideroxylon red ironbark 40/30 70/15/25 15%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$5,564.56 116 9.00 na na Eucalyptus sideroxylon red ironbark 25/15 70/70/80 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $3,976.49 117 48.00 na na Eucalyptus globulus blue gum 70/50 50/80/80 50%-Fair Large Protected Moderate Retain $33,333.03 118 9.00 na na Acacia melanoxylon black acacia 20/15 90/90/90 90%-Excellent Exempt High Retain $1,883.42 119 13.00 20.50 30.50 Eucalyptus camaldulensis red gum 40/35 90/20/40 20%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$5,480.53 120 12.00 20.00 32.00 Eucalyptus sp.Eucalyptus 40/30 40/30/40 30%-Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$14,305.87 121 26.00 20.00 46.00 Eucalyptus sp.Eucalyptus 40/40 50/50/50 50%-Fair Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$47,160.27 122 19.00 23.00 42.00 Eucalyptus sp.Eucalyptus 30/40 10/60/10 10%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$4,598.76 123 24.00 na na Eucalyptus sp.Eucalyptus 35/50 75/50/50 50%-Fair Photo Protected High Remove 4, 10 (6x)24-in. or (3x)36-in.$25,245.65 124 22.00 na na Quercus ilex holly oak 25/25 70/70/80 70%-Good Protected Moderate Retain $29,698.70 125 38.00 na na Quercus douglasii blue oak 40/30 80/60/90 60%-Fair Large Protected Moderate Retain $75,947.32 126 21.00 na na Eucalyptus globulus blue gum 45/15 70/60/50 50%-Fair Photo Exempt High Remove 1, 4, 10, E (2x) 24-in. $6,380.15 127 48.00 na na Eucalyptus globulus blue gum 50/30 70/65/70 65%-Good Photo Large Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$49,523.36 128 10.00 9.00 19.00 Quercus douglasii blue oak 25/20 65/65/65 65%-Good Protected Moderate Retain $10,313.02 Overall tree condition is typical for species. Appears to be a volunteer, originally twin trunked, with secondary trunk failed. Located in the corner of the course by Wedgewood Ave. and La Rinconada park. Possibly, E. microtheca-Coolibah Tree form is asymmetrical due to competition with neighboring trees. Grows in a grove of three, one of which is dead. Tree is under the size requirement for removal permit. Tree grows at top of slope, edge of fairway. Appears to be unmaintained, with full and dense canopy. Left to nature with evidence of branch failures. Decay at base on East side. Codominant structure at 4ft., good union. Form is asymmetrical. Canopy has some large deadwood. One of several trees growing in a naturalized stand. Poor condition overall. Most likely due to environment-high amount of equipment, trash, debris, and a steel shipping container located at the base. Possibly E. macrorhynca-red stringybark. Tree is the same as no. 120 although no. 121 is the larger of the two trees. Possibly E. macrorhynca-red stringybark. Tree is 95% dead. Possibly E. nicholii-Willow Peppermint. Recommend removal. Located in the yard next to the wood pile. Failures in the canopy are evident. Species identification - E. microtheca -Coolibah Several trunk wounds throughout on the east and north side of the trunk. Wound wood is forming good closures. Damage due to mechanical equipment from 0-6ft., roots have also been compromised. Mistletoe noted in the canopy. Nice tree with good form, structure, and health. Owl box mounted in the tree. Several large scaffold limbs have been removed, consecutively up the trunk. Internal decay likely present, appears to be hollow at the base. If failure were to occur, it would likely be from ground level. Poor overall structure and is actively falling apart. Heavy foliage growth with numerous large branch failures. Very poor structure, codominant at 8ft., canopy consists of a large amount of epicormic growth. Appears to be a volunteer, good overall condition. Recommend pruning for structure if not removed. Trees no. 117-123 are located in the yard by la Rinconada Park. No. 117 is a large specimen, good overall structure and form. Health is declining-visible tip dieback indicative of root related issues. Grows on the slope above the creek and the pickle ball court. At the time of inspection, there was a visible sulfur fungus fruiting body growing at the base on the northeast side. This particular fungus is associated with brown rot of hardwoods (e.g. Eucalyptus and Oaks). Recommend monintoring. Young healthy tree, typical for species. Tree is under the size requirement for removal permit. Multi trunk tree with decay at the base and central stem on north side. The main leader has failed and been reduced to 5ft.- dead stump. The form is asymmetrical with all growth to the east, recent large branch failure on the main leader. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 348 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 129 18.00 21.00 39.00 Quercus douglasii blue oak 30/40 65/60/65 60%-Fair Large Protected Moderate Retain $40,235.25 130 18.00 12, 14, & 14 58.00 Quercus douglasii blue oak 35/60 80/80/80 80%-Good Large Protected Moderate Retain $60,309.04 131 13.50 na na Quercus douglasii blue oak 30/25 80/80/60 60%-Fair Protected Moderate Retain $9,585.46 132 20.00 na na Quercus douglasii blue oak 40/50 50/70/60 50%-Fair Protected Low Retain $17,531.70 133 12.00 11 & 10 33.00 Quercus douglasii blue oak 20/30 30/20/20 20%-Fair Large Protected Low Retain $6,399.07 134 31.00 na na Quercus douglasii blue oak 40/55 40/50/50 40%-Poor Large Protected Low Retain $33,695.93 135 24.00 24.00 48.00 Eucalyptus camaldulensis red gum 60/50 80/80/80 80%-Good Photo Large Protected Moderate Remove 4, 10 (6x)24-in. or (3x)36-in.$42,858.38 136 26.50 na na Eucalyptus camaldulensis red gum 60/35 80/50/50 50%-Fair Protected Low Retain $16,328.83 137 30.50 na na Eucalyptus camaldulensis red gum 70/30 80/50/70 50%-Fair Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$21,630.32 138 53.00 na na Eucalyptus camaldulensis red gum 75/80 80/80/80 80%-Good Photo Large Protected High Remove 4, 10 (10x) 24-in. or (5x) 36-in. $104,504.51 139 13.00 na na Quercus douglasii blue oak 20/20 40/50/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $7,407.14 140 26.00 na na Eucalyptus camaldulensis red gum 55/45 70/60/50 50%-Fair Protected Moderate Retain $15,718.46 141 25.00 na na Eucalyptus camaldulensis red gum 60/30 80/80/70 70%-Good Protected Low Retain $20,345.64 142 30.00 na na Quercus douglasii blue oak 30/30 40/50/50 40%-Poor Large Protected Moderate Retain $31,557.06 143 11.70 na na Quercus douglasii blue oak 20/15 80/80/80 80%-Good Protected Low Retain $9,599.66 144 14.00 na na Quercus douglasii blue oak 20/10 20/20/50 20%-Very Poor Protected Low Retain $3,436.21 One of several trees growing in a naturalized stand. Structure is codominant at base with good union. Significant dead wood throughout, form is asymmetrical. A low sprawling tree growing to the west, at tail end of the slope. Large sprawling tree with multiple trunks from base. Located at the bottom of a slope in natural stand. Overall condition is good. Codominant at 8ft. with good union. Condition is typical for species growing in a natural stand. Grows out from beneath larger tree no. 132, making form asymmetrical. Tree canopy comingles with adjacent trees no. 142 and no.143. It is a small tree with single trunk and hollow throughout. Codominant at approx. 12ft. and again throughout upper canopy. Supports branch from tree no. 142. Structure is very poor - tree will fail in time if left alone. Recommend pruning. Large tree, located at the edge of #4 fairway. Codominant with fair union at 8ft. Golf ball damage to the trunk. Overall, tree appears to be in good condition and well-maintained. Small tree that grows beneath canopy of larger eucalyptus. Codominant at approximately 12ft. -tight union. Tree has large sized deadwood throughout. . Codominant at approx. 10ft. with a tight union which will limit future growth. This tree has a potential to split long term, form is asymmetrical. Single trunk tree with good structure. Canopy is asymmetrical due to competition from the adjacent tree no. 140. Large, sprawling tree, the base of the trunk appears slightly buried (no flare). Canopy is asymmetrical with large size deadwood and minimal foliage. The tree appears to be in decline. Growing in a naturalized area. Tree is small in stature, and growing at the edge of #4 fairway, close to the sand trap. Canopy is very asymmetrical growing predominantly to the east due to competition with adjacent trees. Large tree, part of a natural stand, growing at the bottom of the slope. Form is asymmetrical due to competition with other trees. Tree has three trunks from ground level, all appear to be slightly buried. Large failures throughout, decay at base. Tree is declining, appears to be in stage of senescence. Large sprawling tree located in naturalized stand. Significant dead present. Growing beneath a large eucalyptus tree form is slightly asymmetrical. Tree is codominant at 4.5ft.,good union. Growing in a naturalized setting. Large tree growing at the edge of #4 green. Golf ball damage to trunk on northeast side. Canopy has large size deadwood and multiple failures (appears to be naturally self shedding). Single trunk tree, originally a twin trunk tree. Secondary leader removed on the west side. First scaffold limb starts at approximately 25-30ft. Tree has been well-maintained with multiple, large branches removed on the lower trunk (possible internal decay). Golf ball damage to trunk on the northeast side. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 349 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 145 12.50 na na Quercus douglasii blue oak 25/15 85/85/85 85%-Excellent Protected Moderate Retain $11,642.14 146 18.50 na na Quercus douglasii blue oak 30/25 85/85/85 85%-Excellent Protected Moderate Retain $25,500.95 147 44.50 na na Sequoia sempervirens coast redwood 60/35 70/90/90 70%-Good Photo Protected Moderate Remove 4, 10 (4X) 24-in. or (2x) 36-in.$45,838.70 148 33.00 na na Sequoia sempervirens coast redwood 40/30 90/60/60 60%-Fair Photo Protected Moderate Remove 4, 10 (4X) 24-in. or (2x) 36-in.$19,446.25 149 23.00 na na Quercus agrifolia coast live oak 25/35 70/45/45 45%-Fair Protected Moderate Retain $12,300.39 150 19.50 na na Sequoia sempervirens coast redwood 45/20 85/85/80 80%-Good Protected Moderate Retain $9,053.49 151 13.00 na na Sequoia sempervirens coast redwood 30/10 85/70/70 70%-Good Photo Protected Moderate Remove 4, 10 (2x) 24-in. $3,912.00 152 18.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $9,167.33 153 19.00 na na Sequoia sempervirens coast redwood 35/20 90/90/90 90%-Excellent Protected Moderate Retain $10,743.95 154 13.50 na na Sequoia sempervirens coast redwood 35/15 90/90/90 90%-Excellent Protected Moderate Retain $4,881.65 155 15.00 na na Sequoia sempervirens coast redwood 30/15 75/60/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $3,348.18 156 19.00 na na Sequoia sempervirens coast redwood 35/20 80/85/85 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $8,595.16 157 25.00 na na Calocedrus decurrens Incense cedar 35/25 70/70/70 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $22,606.27 158 14.50 na na Quercus agrifolia coast live oak 30/30 80/80/80 80%-Good Protected Moderate Retain $8,691.14 159 27.50 na na Fraxinus velutina Modesto ash 30/30 40/35/35 35%-Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$8,752.81 160 20.50 na na Brachychiton populneus Kurrajong Bottle 35/20 80/70/70 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $15,200.45 Healthy tree, small in stature, and growing at edge of existing sand trap. Young tree, typical species. Bird box on trunk, east side. Growing at the top of a slope in a naturalized area. Codominant at 8ft., with a good union. Canopy is asymmetrical due to competition with other trees. Condition typical for healthy species in naturalized setting. Condition is typical for species. Some thinning of the canopy and minor deadwood. Trunk appears to have some salt buildup from irrigation. Tree has very dense canopy. Appears healthy but top has snapped out, causing structure and form to be compromised. Squat shaped tree, wider than it is tall. Central leader has failed on the east side, compromising structure and form. Otherwise, all unions appear good. Young tree typical for species-looks good. Tree appears to have grown on a lean and then self corrected. Has codominant union, but union is good, tip dieback on one side. Young tree that could benefit from pruning. Healthy, appears typical species. Tree appears to be in decline. It has large size deadwood throughout and a hollow in the center that is capturing water. Young tree, appears healthy, typical for species. Would benefit from pruning. Trees no. 150-156 are growing next to cart path and pump house. Irrigation damage to trunk evident. Tree is smaller than adjacent tree no. 150. Both trees are on the edge of the cart path by the pump house. Young, healthy tree typical for species. Growing next to cart path and pumphouse -canopy have been raised to approximately 12ft. for clearance. Young, healthy tree typical for species. Growing next to cart path and pumphouse -canopy have been raised to approximately 12ft. for clearance. Young, healthy tree typical for species. Growing next to cart path and pumphouse -canopy have been raised to approximately 12ft. for clearance. Young tree alongside the cart path, extensively raised, form is asymmetrical. Codominant at top and could be corrected with pruning. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 350 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 161 30.00 na na Sequoia sempervirens coast redwood 65/20 70/70/60 60%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $17,856.98 162 35.50 na na Sequoia sempervirens coast redwood 65/25 80/75/80 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $28,130.32 163 24.00 na na Quercus douglasii blue oak 30/30 85/85/85 85%-Excellent Large Protected High Retain $42,917.60 164 11.50 na na Pistachio chinensis Chinese pistache 30/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$10,433.55 165 31.00 na na Quercus douglasii blue oak 30/40 85/85/85 85%-Excellent Large Protected Moderate Retain $71,603.84 166 38.00 na na Sequoia sempervirens coast redwood 65/30 70/85/70 70%-Good Protected Moderate Retain $30,083.06 167 15.50 na na Liquidambar styraciflua sweetgum 45/20 40/70/60 40%-Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $5,896.79 168 44.00 na na Fraxinus velutina Modesto ash 35/35 40/40/50 40%-Poor Protected Moderate Retain $25,608.23 169 16.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $8,102.60 170 16.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $5,333.28 171 21.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $13,124.88 172 15.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $6,696.37 173 25.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $19,352.50 174 14.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $5,833.28 175 16.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $7,618.98 176 13.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $5,029.72 Tree appears healthy, typical for speices. Small codominant stem forming, could be corrected with pruning. Bird box mounted on east side. Good structure, form and health. Young tree typical for species. Large section of reaction wood noted at base on west side, down slope-cause unknown. Young, typical for species. Large, old, sprawling tree with evidence of numerous, branch failures. Typical for species of this age that has been left alone. Growing close to #4 Tee. Tree has a thin canopy. Structure and form are typical for species located at the edge of the cart path. Evidence of water spray on the trunk. Tree appears to be in decline Tree has slender form with sparse canopy and downward branching habit, most of the growth to the southwest. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Tree has a large amount of decay in the main trunk from large limb removals. Tip dieback noted throughout the crown. Very asymmetrical in form-tree appears to be in decline. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 351 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 177 28.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $21,756.50 178 14.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $5,833.28 179 15.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Low Remove 4, 10 (3x)24-in. $7,150.23 180 18.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $9,642.77 181 26.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $18,106.98 182 19.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $9,669.55 183 17.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Low Retain $8,601.11 184 13.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $5,424.06 185 15.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Low Retain $7,150.23 186 17.80 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $9,429.68 187 17.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $9,114.50 188 18.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $10,185.92 189 21.30 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $13,502.56 190 17.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $9,114.50 191 13.50 na na Fraxinus velutina Modesto ash 25/30 85/85/85 85%-Excellent Protected Low Retain $5,122.72 192 20.00 na na Quercus agrifolia coast live oak 30/40 40/20/75 20%-Very Poor Protected Low Retain $4,133.72 Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Canopy appears thin, structure is poor. Codominant with included bark and a large crack at approximately 15ft. Tree will fail in time if left alone. Impact irrigation is currently affecting lower foliage. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Trees no. 169-190 are all growing in a grove. All young trees, with good condition and structur- typical for species. Young tree with symmetrical form. Minor amount of mistletoe in canopy. Grows alone on a hillside, no competition. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 352 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 193 29.00 na na Quercus douglasii blue oak 40/40 80/80/70 70%-Good Large Protected Low Retain $51,604.56 194 25.00 na na Quercus douglasii blue oak 35/25 50/70/50 50%-Fair Large Protected Low Retain $27,393.28 195 29.00 na na Quercus douglasii blue oak 45/50 65/85/85 65%-Good Large Protected Low Retain $47,918.52 196 23.00 na na Quercus ilex holly oak 30/30 90/90/90 90%-Excellent Protected Moderate Retain $41,734.21 197 26.00 na na Fraxinus velutina Modesto ash 30/20 0/0/0 Dead Photo Protected Low Remove 1 (3x)24-in. $0.00 198 13.50 na na Quercus douglasii blue oak 25/25 90/90/90 90%-Excellent Protected Low Retain $14,378.18 199 10.00 10 & 10 30.00 Fraxinus velutina Modesto ash 35/35 50/20/50 20%-Fair Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$1,984.11 200 19.50 na na Angophera floribunda rough-barked apple 35/35 60/50/50 50%-Fair Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$16,666.07 201 26.50 na na Sequoia sempervirens coast redwood 50/20 85/85/85 85%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $19,738.99 202 26.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Low Retain $18,106.98 203 25.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Low Retain $16,740.92 204 20.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Low Retain $10,714.19 205 7.00 na na Fraxinus uhdei Shamel ash 50/20 90/60/40 40%-Poor Protected Moderate Retain $486.11 206 20.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Moderate Retain $10,714.19 207 20.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $10,714.19 208 12.50 na na Quercus agrifolia coast live oak 40/25 85/40/30 30%-Poor Protected Moderate Retain $1,937.68 Nice, young tree-good health, form and structure- typical for species. Growing on its own with plenty of space. Codominant with included bark from ground level, most likely a stump sprout. Small stature tree that has dense canopy and large branch failures throughout. Codominant structure with good union at 7ft. Noted: Bird box attached to trunk on the northeast side. Healthy tree, typical for species, stands alone in the rough. Young tree growing alone at fence line-typical for species. Young tree growing alone at fence line-typical for species. Trees no. 193-195 are located close to the bee boxes: Tree no. 193 is a large, mature specimen with sprawling form that is slight asymmetrical. Majority of the growth is to the west. Has significant amount of dead limbs in under story and has been pruned for clearance. Tree appers to be an older specimen that grows to the south. Looks to be in decline with a small amount of foliage present - typical of an older tree. Significant size hollows and deadwood throughout. Sprawling, mature tree with significant amount of large sized deadwood present. Thinning canopy, typical of aging, older tree. Nice tree overall. Tree is an active stage of failure- 99% dead and splitting apart within the upper canopy. Armillaria sp. Fungal fruiting bodies noted at the base of the tree- Recommend removal. Young tree growing alone at fence line-typical for species. Young volunteer, growing out from beneath redwoods along fenceline.Codominant structure at approximately 15ft.Tree is appears out of place and will become longterm issue- recommend removal. Young tree growing alone, along fence line-typical for species. Young tree growing alone, along fence line-typical for species. Young tree, 100% of the canopy grows to the Southwest over the neighboring property. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 353 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 209 10.00 na na Quercus agrifolia coast live oak 25/30 80/30/20 20%-Very Poor Protected Low Retain $826.74 210 12.00 na na Quercus agrifolia coast live oak 45/15 85/85/60 60%-Fair Protected Moderate Retain $2,678.65 211 18.00 18.00 36.00 Sequoia sempervirens coast redwood 30/20 0/0/0 Removed X X X X X $0.00 212 32.00 na na Sequoia sempervirens coast redwood 50/30 90/90/90 90%-Excellent Protected High Retain $30,475.91 213 7.00 na na Sequoia sempervirens coast redwood 20/10 100/100/95 95%-Excellent Protected Moderate Retain $1,539.34 214 18.50 na na Quercus agrifolia coast live oak 30/30 85/60/50 50%-Fair Protected Low Retain $61,895.96 215 13.00 na na Quercus agrifolia coast live oak 25/20 85/60/30 30%-Poor Protected Low Retain $2,095.79 216 14.00 na na Sequoia sempervirens coast redwood 30/20 40/90/90 40%-Poor Protected Moderate Retain $2,333.31 217 14.00 na na Sequoia sempervirens coast redwood 35/20 40/90/90 40%-Poor Protected Moderate Retain $2,333.31 218 18.00 na na Sequoia sempervirens coast redwood 35/20 30/60/70 30%-Poor Protected Low Retain $3,214.26 219 16.00 na na Sequoia sempervirens coast redwood 35/20 40/90/90 40%-Poor Protected Moderate Retain $3,047.59 220 17.00 na na Sequoia sempervirens coast redwood 35/20 40/90/90 40%-Poor Protected Moderate Retain $3,440.44 221 17.00 na na Sequoia sempervirens coast redwood 30/20 40/90/90 40%-Poor Protected Moderate Retain $3,440.44 222 42.00 na na Sequoia sempervirens coast redwood 50/30 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$49,582.88 223 24.00 na na Sequoia sempervirens coast redwood 45/15 85/80/45 45%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $8,571.35 224 37.50 na na Sequoia sempervirens coast redwood 50/25 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $39,527.17 Trees no. 216-221 are all growing adjacent to the ball netting. All appear to have slightly chlorotic foliage. Trees no. 216-221 are all growing adjacent to the ball netting. All appear to have slightly chlorotic foliage. Trees no. 216-221 are all growing adjacent to the ball netting. All appear to have slightly chlorotic foliage. Dying/dead top in this particular tree. Trees no. 216-221 are all growing adjacent to the ball netting. All appear to have slightly chlorotic foliage. Trees no. 216-221 are all growing adjacent to the ball netting. All appear to have slightly chlorotic foliage. Trees no. 216-221 are all growing adjacent to the ball netting. All appear to have slightly chlorotic foliage. Relatively young, single trunk tree growing between cart path and fence. Canopy has been maintained for clearance from powerlines. Removed by PG&E Young tree typical for species Young tree typical for species Growing at fence line, has an asymmetrical canopy and chain-link fence embedded in the trunk between 2-4ft. Growing at fence line, has an asymmetrical canopy and chain-link fence embedded in trunk between 2-4ft. Canopy is codominant and included at approximately 10ft. Future room for growth is limited by ball netting. Young tree, canopy grows on a 45° angle towards neighboring property. Tree has no room for growth-consider removal long-term. Trees no. 222-224 are all next to the powerlines. Good condition, typical for species. Very poor form, overcrowded between trees and next to powerline. Recommend removal-no long-term future. Grows next to powerlines. Overall condition is typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 354 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 225 18.50 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected High Retain $10,185.92 226 25.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected High Retain $16,740.92 227 28.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected High Retain $20,999.81 228 25.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected High Retain $16,740.92 229 22.00 na na Sequoia sempervirens coast redwood 30/21 60/90/90 60%-Fair Protected High Retain $9,603.09 230 27.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $21,696.23 231 23.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $15,743.90 232 40.00 na na Quercus douglasii blue oak 35/40 85/60/80 60%-Fair Protected Moderate Retain $75,736.94 233 15.00 na na Quercus agrifolia coast live oak 25/20 40/85/85 40%-Poor Protected Moderate Retain $4,650.43 234 10.50 na na Sequoia sempervirens coast redwood 25/10 90/90/90 90%-Excellent Protected Moderate Retain $2,953.10 235 10.00 na na Sequoia sempervirens coast redwood 25/10 90/90/90 90%-Excellent Protected Moderate Retain $2,678.55 236 12.50 na na Sequoia sempervirens coast redwood 30/10 90/90/90 90%-Excellent Protected Moderate Retain $4,650.26 237 16.50 na na Sequoia sempervirens coast redwood 25/10 90/90/90 90%-Excellent Protected Moderate Retain $8,102.60 238 11.50 na na Sequoia sempervirens coast redwood 30/10 90/90/90 90%-Excellent Protected Low Retain $3,935.98 239 11.50 na na Sequoia sempervirens coast redwood 30/10 90/90/90 90%-Excellent Protected Moderate Retain $3,935.98 240 11.00 na na Sequoia sempervirens coast redwood 25/10 90/90/90 90%-Excellent Protected Moderate Retain $3,241.04 Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 227-231 are all young and healthy, typical for species. Trees no. 227-231 are all young and healthy, typical for species. Trees no. 227-231 are all young and healthy, typical for species. Trees no. 227-231 are all young and healthy, typical for species. Large, older specimen that appears to be in good health. Grows on a heavy lean to the east with large amount of reaction wood noted on back-side of lean. Canopy appears stunted, gray in color. Could be related to irrigation overspray. Lower branches on Northwest side are dying. No trunk flare, appears buried. Possibly in state of decline. Young, healthy tree typical for species. Powerline runs between no. 225 and 226-recommend removal due to location. Young, healthy tree typical for species. Powerline runs between no. 225 and 226 Trees no. 227-231 are all young and healthy, typical for species. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 355 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 241 10.00 na na Sequoia sempervirens coast redwood 25/8 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (2x) 24-in. $2,976.16 242 10.00 na na Sequoia sempervirens coast redwood 25/8 90/90/90 90%-Excellent Protected Moderate Retain $2,976.16 243 16.70 na na Sequoia sempervirens coast redwood 30/10 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (2x) 24-in. $8,300.22 244 12.50 na na Sequoia sempervirens coast redwood 25/10 90/90/90 90%-Excellent Protected Moderate Retain $4,650.26 245 9.00 na na Sequoia sempervirens coast redwood 20/10 90/90/90 90%-Excellent Protected Moderate Retain $2,169.62 246 9.00 na na Lagerstroemia sp.crape myrtle 20/15 85/80/90 80%-Good Protected Moderate Retain $6,087.93 247 4.50 na na Lagerstroemia sp.crape myrtle 15/10 85/80/90 80%-Good Protected Moderate Retain $1,521.98 248 6.50 na na Lagerstroemia sp.crape myrtle 20/15 85/80/90 80%-Good Protected Moderate Retain $3,175.49 249 7.00 na na Lagerstroemia sp.crape myrtle 20/20 85/80/90 80%-Good Protected Moderate Retain $3,682.82 250 6.50 na na Lagerstroemia sp.crape myrtle 20/15 85/80/90 80%-Good Protected Moderate Retain $3,175.49 251 7.00 na na Lagerstroemia sp.crape myrtle 25/15 85/80/90 80%-Good Protected Moderate Retain $3,682.82 252 4.40 na na Lagerstroemia sp.crape myrtle 20/10 85/80/90 80%-Good Protected Moderate Retain $1,455.09 253 8.00 na na Lagerstroemia sp.crape myrtle 25/20 85/80/90 80%-Good Protected Moderate Retain $4,810.22 254 7.50 na na Lagerstroemia sp.crape myrtle 25/20 85/80/90 80%-Good Protected Moderate Retain $4,227.73 255 7.70 na na Lagerstroemia sp.crape myrtle 25/20 85/80/90 80%-Good Protected Moderate Retain $4,456.21 256 8.60 na na Lagerstroemia sp.crape myrtle 25/20 85/80/90 80%-Good Protected Moderate Retain $5,558.81 Trees no. 246-262 are all in good condition, growing next to cart path. This tree has a small trunk wound on the west side. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Trees no. 234-245 are all young, healthy trees growing in a grove next to the cart path and #5 fairway. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 356 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 257 5.00 na na Lagerstroemia sp.crape myrtle 15/10 85/80/90 80%-Good Protected Moderate Retain $1,878.99 258 5.00 na na Lagerstroemia sp.crape myrtle 15/10 85/20/90 20%-Fair Protected Moderate Retain $469.75 259 5.00 na na Lagerstroemia sp.crape myrtle 15/10 85/80/90 80%-Good Protected Moderate Retain $1,878.99 260 5.00 na na Lagerstroemia sp.crape myrtle 15/8 85/06/90 6%-Very Poor Protected High Retain $1,409.24 261 4.50 na na Lagerstroemia sp.crape myrtle 15/10 85/80/90 80%-Good Protected High Retain $1,521.98 262 4.50 na na Lagerstroemia sp.crape myrtle 15/8 85/80/90 80%-Good Protected Moderate Retain $1,521.98 263 16.50 11 & 10 37.50 Quercus agrifolia coast live oak 40/40 80/40/50 40%-Poor Large Protected Moderate Retain $8,155.82 264 10.00 7.00 17.00 Quercus lobata valley oak 20/20 85/6/6 6%-Very Poor Protected Moderate Retain $626.93 265 24.00 na na Sequoia sempervirens coast redwood 50/25 85/85/85 85%-Excellent Protected High Retain $14,571.30 266 23.50 na na Sequoia sempervirens coast redwood 50/20 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $13,970.48 267 35.00 na na Sequoia sempervirens coast redwood 65/15 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $30,989.30 268 43.00 na na Sequoia sempervirens coast redwood 65/25 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $46,774.87 269 30.50 na na Sequoia sempervirens coast redwood 60/20 85/85/70 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $19,380.03 270 8.00 na na Betula pendula European white birch 20/15 70/80/90 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $2,314.88 271 6.70 na na Betula pendula European white birch 20/10 70/80/70 70%-Good Photo Protected High Remove 4, 10 (2x) 24-in. $1,623.67 272 74.50 na na Eucalyptus camaldulensis red gum 70/60 85/80/75 75%-Good Large Protected Moderate Retain $193,582.95 Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Tree is small in stature and well formed. Small amount of dead wood present, could benefit from structure pruning. Generally good condition, tree is typical for species. Large and majestic. Recently suffered large limb failures and was subsequently pruned to clean up the damaged branches. Large wounds are in process of closing over. Codominant and heavily included from 6in. above ground level. Growing in poor location, has poor structure with trunks that twist around each other. Impedes canopy of adjacent tree, overhangs parking area-consider for long term removal. Tree no. 265-269 are all growing in a grove. Good health, form, and vigor-typical for species. Tree no. 265-269 are all growing in a grove. Good health, form, and vigor-typical for species. Tree no. 265-269 are all growing in a grove. Good health, form, and vigor-typical for species. Tree no. 267 & 268 are growing close together. Tree no. 265-269 are all growing in a grove. Good health, form, and vigor-typical for species. Tree has a very "S" formation in the trunk, which appears to have self corrected with age. Tree no. 265-269 are all growing in a grove. Good health, form, and vigor-typical for species. This tree has a very asymmetrical form and is thin on the east side. This tree is healthy with good form but poor structure. There is evidence of an internal crack, it will likely split with time. Recommend long term removal and replacement. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. This is a healthy tree with good form but Very Poor structure. It has a trunk wound that is beyond repair-recommend removal and replacement. Half of the tree has ripped out on the west side. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Trees no. 246-262 all grow in a line alongside the cart path. All are in good condition with the exception of no. 258 & 260. Tree has small trunk wound. Young, mulit trunk tree growing at the top of the slope, above parking lot and next to the cart path. Three main stems all have included bark. Two of the three trunks could be pruned to maintain form and structure. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 357 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 273 28.00 na na Quercus douglasii blue oak 30/50 80/80/70 70%-Good Large Protected High Retain $48,106.98 274 20.00 na na Sequoia sempervirens coast redwood 50/15 50/90/90 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $5,290.96 275 42.50 na na Sequoia sempervirens coast redwood 60/20 70/90/85 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $37,629.87 276 28.50 na na Sequoia sempervirens coast redwood 55/10 70/90/85 70%-Good Photo Protected Moderate Remove 4, 10 (2x) 24-in. $16,921.72 277 32.50 na na Sequoia sempervirens coast redwood 55/10 70/90/85 70%-Good Photo Protected Moderate Remove 4, 10 (2x) 24-in. $22,005.01 278 24.00 na na Sequoia sempervirens coast redwood 50/10 70/90/85 70%-Good Photo Protected Moderate Remove 4, 10 (2x) 24-in. $11,999.89 279 23.00 na na Sequoia sempervirens coast redwood 50/10 70/90/85 70%-Good Protected Moderate Retain $11,020.73 280 30.00 na na Sequoia sempervirens coast redwood 55/20 70/90/70 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $18,749.83 281 57.00 na na Sequoia sempervirens coast redwood 60/25 70/80/70 70%-Good Large Protected Moderate Retain $67,686.88 282 43.50 na na Sequoia sempervirens coast redwood 60/20 70/80/70 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $39,421.52 283 15.00 na na Sequoia sempervirens coast redwood 40/15 70/90/85 70%-Good Protected Moderate Retain $4,687.46 284 16.50 na na Sequoia sempervirens coast redwood 40/10 70/90/85 70%-Good Photo Protected Moderate Remove 4, 10 (2x) 24-in. $5,671.82 285 34.00 na na Sequoia sempervirens coast redwood 60/25 70/90/85 70%-Good Protected High Retain $24,083.11 286 16.00 na na Sequoia sempervirens coast redwood 35/10 70/90/85 70%-Good Protected High Retain $5,333.28 287 20.50 13.00 33.50 Quercus agrifolia coast live oak 30/35 80/80/60 60%-Fair Large Protected Moderate Retain $16,441.60 288 45.00 na na Sequoia sempervirens coast redwood 65/30 90/90/90 90%-Excellent Protected Moderate Retain $60,267.31 Large, healthy, old tree with canopy growth predominantly to the west. Evidence of mechanical wounding on the lower trunk. Generally a nice looking tree. Young tree with limited growing area between cart path and roadway. Canopy foliage appears thin for the species. Mature size tree in good overall condition. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. This tree has minor codominance at top and can be corrected with pruning. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Low spreading tree. Maintained for vehicle, parking, and cart path clearance. Form has been compromised from natural stature due to pruning. Overall structure is good but foliage size appears smaller than normal for species. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. Trees no. 276-286 are all growing alongside the clubhouse. They appear good overall, typical for healthy species unless noted otherwise. Leans to the north slightly. Trees no. 276-286 are all growing in a line alongside the clubhouse. Condition overall is good, they appear healthy -typical for species unless noted otherwise. This tree has minor codominance and can be corrected with pruning. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 358 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 289 43.00 na na Sequoia sempervirens coast redwood 65/30 90/90/90 90%-Excellent Protected Moderate Retain $55,029.26 290 43.50 na na Sequoia sempervirens coast redwood 65/30 90/90/90 90%-Excellent Protected Moderate Retain $56,316.45 291 36.00 na na Sequoia sempervirens coast redwood 55/30 30/80/85 30%-Poor Photo Protected Moderate Remove 4, 10 (3x)24-in. $11,571.32 292 29.00 na na Sequoia sempervirens coast redwood 60/20 30/85/85 30%-Poor Protected Moderate Retain $7,508.86 293 25.00 na na Sequoia sempervirens coast redwood 55/20 30/85/85 30%-Poor Protected Moderate Retain $6,200.34 294 37.00 na na Sequoia sempervirens coast redwood 60/25 30/20/20 20%-Fair Photo Protected Moderate Remove 1, 4, 10 (3x)24-in. $8,148.74 295 37.00 na na Sequoia sempervirens coast redwood 60/25 50/60/65 50%-Fair Protected Moderate Retain $22,635.38 296 34.00 na na Sequoia sempervirens coast redwood 55/20 80/65/60 60%-Fair Protected Moderate Retain $22,936.30 297 25.00 na na Sequoia sempervirens coast redwood 55/20 30/85/85 30%-Poor Protected Moderate Retain $5,580.31 298 25.00 na na Sequoia sempervirens coast redwood 55/20 30/60/70 30%-Poor Protected Moderate Retain $5,580.31 299 27.00 na na Sequoia sempervirens coast redwood 55/20 30/60/70 30%-Poor Protected Moderate Retain $6,508.87 300 40.00 na na Fraxinus velutina Modesto ash 25/20 60/20/20 20%-Fair Photo Protected High HR 1 (3x)24-in. $10,581.91 301 42.00 na na Sequoia sempervirens coast redwood 65/30 85/80/85 80%-Good Protected Moderate Retain $46,666.24 302 32.50 na na Sequoia sempervirens coast redwood 60/15 70/85/85 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $24,450.01 303 34.00 na na Sequoia sempervirens coast redwood 60/15 85/30/85 30%-Poor Photo Protected High Remove 4, 10 (3x)24-in. $11,468.15 304 40.00 na na Sequoia sempervirens coast redwood 60/20 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $44,973.13 Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Canopies of no. 291-293 appears sparse, perhaps stressed with approximately 50% foliage density. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Canopies of no. 291-293 appears sparse, perhaps stressed with approximately 50% foliage density. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Canopies of no. 291-293 appears sparse, perhaps stressed with approximately 50% foliage density. Currently in decline and has a hanger over cart path. Small palm tree growing between the union of main leaders. Foreign plant growth is indicative of soil build up and moisture. The structure is extremely poor, half of the tree already failed. Remainder leans over the cart path. Recommend tree removal. Hazardous. Tree is large and stands on its own, not in a grove. Overall condition appears to be great. Minor codominance in upper canopy that can be corrected with pruning. Good condition, typical for healthy species. Codominant at approximately 20ft. Noted irrigation damage to the trunk. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Tree had a large dead top that was recently removed (1/3 of canopy). Death of tree top is typically an indicator of root related issues. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Trunk is very twisted, has naturally grown that way. The canopy is thinner than that of a healthy specimen approximately 60% foliage density. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. This tree appears to have had a second leader at one time, on the north side (no root flare at the base and some decay noted). Minimal canopy coverage to the east. Trees no. 288-297 are all growing together, close to cart path. Understory maintained with mulch. Trees no. 297-299 all have sparse canopies, they are developing codominant tops or have had dead tops recently removed. Dead top. Dead top. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 359 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 305 61.50 na na Eucalyptus camaldulensis red gum 70/45 85/60/70 60%-Fair Photo Large Protected High Remove 4, 10 (6x)24-in. or (3x)36-in.$105,534.58 306 54.00 na na Eucalyptus camaldulensis red gum 70/45 85/75/70 70%-Good Photo Large Protected Moderate Remove 4, 10 (6x)24-in. or (3x)36-in.$94,924.62 307 16.00 na na Quercus agrifolia coast live oak 30/25 80/85/80 80%-Good Protected High Retain $9,524.08 308 17.50 na na Quercus agrifolia coast live oak 30/25 80/85/85 80%-Good Protected High Retain $11,393.56 309 9.00 8 & 5 22.00 Quercus ilex holly oak 20/15 90/90/90 90%-Excellent Protected High Retain $12,070.57 310 32.50 na na Sequoia sempervirens coast redwood 50/20 60/90/85 60%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $18,861.44 311 20.00 na na Quercus agrifolia coast live oak 30/25 50/65/70 50%-Fair Protected High Retain $9,300.86 312 16.50 na na Quercus agrifolia coast live oak 30/25 85/30/80 30%-Poor Protected High Retain $3,798.24 313 24.00 na na Quercus douglasii blue oak 25/40 80/60/70 60%-Fair Large Protected Moderate Retain $30,294.78 314 28.00 22.00 40.00 Sequoia sempervirens coast redwood 45/25 85/60/80 60%-Fair Protected High Retain $25,158.50 315 16.50 na na Sequoia sempervirens coast redwood 40/15 60/90/90 60%-Fair Protected Moderate Retain $5,401.74 316 15.00 na na Sequoia sempervirens coast redwood 35/10 85/85/85 85%-Excellent Protected Moderate Retain $6,324.35 317 32.00 na na Sequoia sempervirens coast redwood 55/20 80/90/90 80%-Good Protected High Retain $27,089.70 318 51.00 na na Sequoia sempervirens coast redwood 60/25 80/90/90 80%-Good Large Protected High Retain $68,808.90 319 20.00 na na Sequoia sempervirens coast redwood 35/15 85/40/85 40%-Poor Photo Protected High Remove 4, 10 (3x)24-in. $5,290.96 320 45.00 na na Sequoia sempervirens coast redwood 60/25 90/90/90 90%-Excellent Protected Moderate Retain $60,267.31 Large, single trunk tree that becomes codominant at approximately 18-20ft. Canopy growth is mainly to the northwest. asymetrical form is due to previous large limb failures and pruning over the last decade. Noted burl at base on the east side. Young oak tree, overall good condition. Growing at the edge of neighboring Eucalyptus, tree no.57. Young, healthy tree typical for species. Tree grows in a small grove with three other trees of same genus-understory is maintainded with mulch. Small amount of mechanical damage to the base of trunk on north side, wound appears to have healed over. Overall, health of the tree is good. Mature specimen growing next to cart path that has recently been replaced on the east side. Canopy is relatively thin. Irrigation appears to be hitting the trunk on north side. Irrigation currently hits lower canopy, causing water overspray to lower foliage. Trunk form is short and wide. Bark crack appears to be forming at the base of the tree and runs up to the first branch union on both the east and north side of the trunk. Codominant structure with poor unions throughout. Large, codominant tree at 4.5ft., with included bark. Tree is located at the edge of the cart path. Pruned to reduce heavy end weight and remove large limbs over the course, on east side. Large wound at base on east side and northwest side. Tree no. 317 & 318 are larger sized specimens. Good overall condition, typical for a healthy species. Codominant structure and included bark at approximately 10ft. Basal sprouts are present-possibly a response to mechanical damage. Trees no. 320-326 are all growing in a grove. Understory of has been maintained with mulch. Sprawling form and codominant structure with very poor branch unions. Approximately five branch unions originate at 7ft. Sapsucker damage to upper canopy scaffold limbs. Tree fell over and has continued to grow along the ground. Twin trunk tree from ground level with fair union. Foliage and form appear healthy and good. Young tree growing within a grove of sixteen redwoods. Canopy appears thinner than normal, healthy specimen. Young, healthy tree. Typical condition for a healthy species Tree no. 317 & 318 are larger sized specimens. Good overall condition, typical for a healthy species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 360 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 321 33.00 na na Sequoia sempervirens coast redwood 55/20 90/40/85 40%-Poor Protected Moderate Retain $14,404.63 322 30.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Photo Protected Low Remove 4, 10 (3x)24-in. $26,785.47 323 29.00 na na Sequoia sempervirens coast redwood 50/20 80/90/90 80%-Good Protected Low Retain $22,248.47 324 25.00 na na Sequoia sempervirens coast redwood 55/20 90/90/90 90%-Excellent Protected Low Retain $18,601.02 325 21.00 19.00 40.00 Sequoia sempervirens coast redwood 50/15 90/50/80 50%-Fair Photo Protected Moderate Remove 4, 10 (3x)24-in. $13,260.46 326 38.50 na na Sequoia sempervirens coast redwood 60/15 85/75/85 75%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $36,761.82 327 37.00 na na Sequoia sempervirens coast redwood 60/25 60/85/85 60%-Fair Protected Moderate Retain $72,002.69 328 23.00 na na Quercus ilex holly oak 35/25 85/75/65 65%-Good Protected High Retain $11,370.60 329 10.50 na na Sequoia sempervirens coast redwood 30/10 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (2x) 24-in. $3,281.22 330 29.00 na na Sequoia sempervirens coast redwood 45/30 90/90/90 90%-Excellent Protected High Retain $25,029.53 331 21.00 na na Sequoia sempervirens coast redwood 40/30 90/90/90 90%-Excellent Protected Moderate Retain $13,124.88 332 24.00 na na Sequoia sempervirens coast redwood 45/30 90/90/90 90%-Excellent Protected Moderate Retain $17,142.70 333 30.00 na na Sequoia sempervirens coast redwood 55/30 90/90/90 90%-Excellent Protected Moderate Retain $26,785.47 334 30.00 na na Sequoia sempervirens coast redwood 55/30 90/80/90 80%-Good Photo Protected Moderate Remove 4, 10 (4X) 24-in. or (2x) 36-in.$21,428.38 335 37.00 na na Eucalyptus camaldulensis red gum 65/50 80/70/45 45%-Fair Photo Protected High Remove 4, 10 (6x)24-in. or (3x)36-in.$25,465.77 336 12.50 na na Sequoia sempervirens coast redwood 25/10 95/95/95 95%-Excellent Photo Protected High Remove 4, 10 (2x) 24-in. $4,908.60 Trees no. 322-324 are all in generally good condition-typical for healthy species. Codominant at 1-2ft. Top of the tree appears to have a small, twin leader that should be corrected with pruning. Fair health Canopy growth is predominantly to the south. Could be related to wind exposure-tree stand alone in the rough.. Young, healthy tree typical for species. Codominant structure with included bark at approximately 5ft. Multiple codominance again in upper canopy. Recommend smaller stem to be removed. Trees no. 322-324 are all in generally good condition-typical for healthy species. Trees no. 322-324 are all in generally good condition-typical for healthy species. Trees no. 336-337 are both young trees with good overall condition-typical species. Trees no.330-334 are a healthy stand of redwoods-understories maintained with mulch. Minor damage to the trunk by irrigation impact on the southwest side. Trees no.330-334 are a healthy stand of redwoods-understories maintained with mulch. Trees no.330-334 are a healthy stand of redwoods-understories maintained with mulch. Trees no.330-334 are a healthy stand of redwoods-understories maintained with mulch. Trees no.330-334 are a healthy stand of redwoods-understories maintained with mulch. Recommend removal of smaller codominant leader. Large, squat tree with significan golf ball damage to trunk. Tree is growing primarily to the north with good overall structure and slightly asymmetrical form. Skewed form is due to the recently failed adjace tree, of same size and stature. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 361 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 337 8.00 na na Sequoia sempervirens coast redwood 20/10 95/95/95 95%-Excellent Photo Protected High Remove 4, 10 (2x) 24-in. $1,809.51 338 36.00 na na Eucalyptus camaldulensis red gum 60/20 80/50/55 50%-Fair Protected High Retain $26,786.49 339 45.00 na na Eucalyptus sp.Eucalyptus 70/40 85/70/85 70%-Good Protected Moderate Retain $99,404.73 340 34.00 na na Eucalyptus sp.Eucalyptus 60/40 70/30/40 30%-Poor Photo Protected Moderate Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$27,359.97 341 22.00 na na Pinus canariensis Canary Island pine 60/20 90/90/90 90%-Excellent Protected Moderate Retain $20,257.28 342 20.00 na na Sequoia sempervirens coast redwood 50/20 85/85/85 85%-Excellent Protected Moderate Retain $11,243.28 343 18.50 na na Sequoia sempervirens coast redwood 50/20 85/85/85 85%-Excellent Protected Moderate Retain $9,620.03 344 19.00 na na Sequoia sempervirens coast redwood 50/20 85/85/85 85%-Excellent Protected Moderate Retain $10,147.06 345 17.50 na na Sequoia sempervirens coast redwood 50/20 85/85/85 85%-Excellent Protected Moderate Retain $8,608.14 346 30.00 na na Sequoia sempervirens coast redwood 60/30 70/85/85 70%-Good Protected Moderate Retain $18,749.83 347 13.00 na na Sequoia sempervirens coast redwood 35/15 85/85/85 85%-Excellent Protected Moderate Retain $4,750.29 348 19.50 na na Sequoia sempervirens coast redwood 40/15 85/85/85 85%-Excellent Protected Moderate Retain $10,688.15 349 11.50 na na Sequoia sempervirens coast redwood 30/10 85/85/85 85%-Excellent Protected Moderate Retain $3,345.58 350 15.50 na na Sequoia sempervirens coast redwood 40/15 85/85/85 85%-Excellent Protected Moderate Retain $6,077.70 351 16.00 na na Sequoia sempervirens coast redwood 40/15 85/85/85 85%-Excellent Protected Moderate Retain $6,476.13 352 26.00 na na Sequoia sempervirens coast redwood 55/20 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $19,001.15 Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Trees no. 336-337 are both young trees with good overall condition-typical species. Tree has suffered major failures. Canopy has been heavily pruned to reduce heavy end weight and to clean up failed branches. Large, old specimen that has had a recent, large failure in the upper canopy. Grows at the edge of the current cart path. Structure is severely compromised, due to large failures at approximately 30ft. Possibly E. cephalocarpa -Stringy bark Good looking pine tree growing next to the bunkhouse Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree no. 342-351 are all a healthy looking trees growing around the pumphouse. They appear consistently healthy, with good ostructure and form. Understory is maintained with mulch. Tree stands alone and has small codominant tip which can be corrected with pruning. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 362 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 353 16.00 na na Fraxinus uhdei Shamel ash 45/30 80/80/80 80%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$5,079.32 354 17.00 na na Sequoia sempervirens coast redwood 45/15 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $7,741.00 355 37.00 na na Sequoia sempervirens coast redwood 55/15 70/60/60 60%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $24,446.21 356 27.00 na na Pinus canariensis Canary Island pine 50/25 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $23,731.15 357 35.50 na na Sequoia sempervirens coast redwood 50/20 70/90/90 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $26,254.97 358 30.00 na na Sequoia sempervirens coast redwood 40/20 60/90/90 60%-Fair Photo Protected Moderate Remove 4, 10 (3x)24-in. $16,071.28 359 19.00 na na Fraxinus uhdei Shamel ash 35/30 80/80/80 80%-Good Protected Moderate Retain $7,162.63 360 22.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Moderate Retain $12,964.17 361 46.00 na na Sequoia sempervirens coast redwood 40/25 90/80/90 80%-Good Protected Moderate Retain $50,380.49 362 25.00 na na Pinus canariensis Canary Island pine 50/25 90/90/90 90%-Excellent Photo Protected Low Remove 4, 10 (3x)24-in. $20,345.64 363 47.00 na na Sequoia sempervirens coast redwood 60/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$59,169.10 364 33.00 na na Sequoia sempervirens coast redwood 60/15 85/85/85 85%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $30,609.84 365 40.00 na na Sequoia sempervirens coast redwood 60/25 85/85/85 85%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $44,973.13 366 38.50 na na Sequoia sempervirens coast redwood 60/40 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$44,114.18 367 27.00 na na Sequoia sempervirens coast redwood 55/20 60/90/90 60%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $14,464.15 368 43.00 na na Sequoia sempervirens coast redwood 55/20 70/85/90 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $42,800.54 Nice, young tree with overall condition typical of healthy species. Grows close to the cart path. Tree no. 361 appears to have lost the top of its canopy. No significant change to the overall structure and form, however, it needs to be maintained. Should monitor if not removed-could make a good habitat tree for large predatory birds such as an owls. Tree no. 362 is a nice looking tree with a slight natural lean to the southeast. Tree no. 363 grows at the end of a grove, across from clubhouse and appears to be in good condition. Tree no. 364 appears to be good overall condition. Grows between edge of grove and sand trap, across from the clubhouse. Tree no. 365 appears to be good overall condition and grows between edge of grove and sand trap, across from the clubhouse. Young healthy tree, typical for species. Canopy has been raised for clearance. Large tree with a mounding base and large amount of basal sprouts. Tree has grown to the southeast on a lean and then self corrected. There is minimal foliage on the east side, indicative of being surrounded by a larger tree that has since failed or been removed. Growing too close to cart path and concrete is already cracking. Tree no. 357 and 358 both have thin canopies and are growing next to the cart path. Tree no. 357 and 358 both have thin canopies and are growing next to the cart path. Tree no. 359 has mechanical damage at the base, on the northeast side. Overall a normal, healthy appearing tree. Young, healthy tree with good structure and form. Tree no. 366 appears very healthy, growing towards the bottom of the slope. Tree stands alone, away from grove-has a slight lean to the South due to wind. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. This particular tree, no. 367 has a thinner canopy than others in the stand. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 363 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 369 19.00 na na Sequoia sempervirens coast redwood 30/20 85/75/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $8,953.29 370 28.00 na na Sequoia sempervirens coast redwood 55/15 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $22,036.84 371 21.50 na na Sequoia sempervirens coast redwood 40/15 85/70/85 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $10,700.13 372 29.00 na na Sequoia sempervirens coast redwood 50/15 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $23,639.00 373 38.00 na na Sequoia sempervirens coast redwood 45/15 85/75/85 75%-Good Photo Protected High Remove 4, 10 (3x)24-in. $35,813.17 374 37.50 na na Sequoia sempervirens coast redwood 55/15 85/85/85 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $39,527.17 375 45.00 na na Sequoia sempervirens coast redwood 36/25 80/60/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $26,785.47 376 23.00 18.00 41.00 Quercus agrifolia coast live oak 35/40 80/70/80 70%-Good Large Protected Low Retain $27,767.73 377 11.50 7.00 18.50 Olea europaea olive 30/20 80/50/50 50%-Fair Protected Low Retain $4,214.45 378 11.50 na na Olea europaea olive 30/20 80/30/25 25%-Poor Protected Low Retain $1,537.55 379 12.50 9.50 22.00 Olea europaea olive 30/20 80/50/50 50%-Fair Protected Low Retain $5,731.66 380 11.40 na na Olea europaea olive 30/20 80/50/50 50%-Fair Protected Low Retain $3,021.85 381 11.70 8.50 20.20 Olea europaea olive 30/25 80/50/50 50%-Fair Protected Low Retain $4,862.96 382 17.50 na na Olea europaea olive 30/20 80/50/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $7,120.97 383 22.00 na na Olea europaea olive 30/15 85/25/20 20%-Very Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $4,501.62 384 15.00 12.00 27.00 Olea europaea olive 30/10 80/50/50 50%-Fair Protected Moderate Retain $8,580.05 Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. This particular tree grows on a heavy lean, one half of the tree has failed and been removed at 3ft. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Tree appears to have lost the top and regrown. Lost top does not appear to be affecting the structure at this time, but could be corrected with pruning. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Trees no. 375 grows close to the cart path and has lost the top of the canopy. Remaining portion of the tree appears healthy. Tree no. 376 is located on the corner of the main entrance and cart path leading to #10. Trunk is somewhat buried and structure is codominant from 1- 2ft. with a third stem previously removed. A visible external seem in the trunk bark may be indicative of bark inclusion or internal cracking. In general, the tree appears to be well maintained with good unions. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Top of this tree leans over to the west, whole tree is slightly twisted. Trees no. 367-374 are all growing in a grove close to the clubhouse. The ground below the canopies have been maintained with mulch. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 364 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 385 11.00 11, 9 & 6 37.00 Olea europaea olive 30/20 80/50/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $8,347.53 386 37.00 na na Sequoia sempervirens coast redwood 60/25 80/90/90 80%-Good Protected High Retain $32,594.94 387 26.00 na na Sequoia sempervirens coast redwood 60/20 80/90/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $10,059.43 388 24.00 na na Sequoia sempervirens coast redwood 60/15 80/90/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $8,571.35 389 32.00 na na Sequoia sempervirens coast redwood 40/25 80/30/30 30%-Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $9,142.77 390 29.50 na na Sequoia sempervirens coast redwood 60/25 70/80/90 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $18,130.04 391 39.00 na na Fraxinus uhdei Shamel ash 65/60 80/50/70 50%-Fair Protected High Retain $18,861.44 392 43.50 na na Fraxinus uhdei Shamel ash 65/60 80/10/40 10%-Very Poor Photo Protected Moderate Remove 1, 4, 10 (10x) 24-in. or (5x) 36-in. $4,693.04 393 43.00 na na Fraxinus uhdei Shamel ash 65/60 80/30/30 30%-Poor Protected Moderate Retain $13,757.32 394 18.50 na na Fraxinus velutina Modesto ash 30/20 50/10/10 10%-Very Poor Photo Protected Moderate Remove 1, 4, 10 (3x)24-in. $990.30 395 22.00 na na Fraxinus velutina Modesto ash 40/20 40/10/50 10%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $1,400.45 396 26.00 na na Fraxinus uhdei Shamel ash 60/50 70/40/70 10%-Very Poor Protected Low Retain $1,676.57 397 18.50 na na Fraxinus velutina Modesto ash 46/25 60/40/40 40%-Poor Photo Protected Moderate Remove 1, 4, 10 (3x)24-in. $3,961.19 398 36.50 na na Fraxinus uhdei Shamel ash 60/50 80/20/20 20%-Very Poor Photo Protected Low HR 1 (6x)24-in. or (3x)36-in.$6,608.32 399 45.00 na na Sequoia sempervirens coast redwood 60/25 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $60,267.31 400 41.00 23 & 18 82.00 Quercus agrifolia coast live oak 40/60 90/80/90 80%-Good Protected Moderate Retain $89,036.14 Consecutive, large branch removals on the southeast side of the trunk, between 6-10ft. There are three main scaffold limbs at approximately 15ft. Overall, the structures is compromised. Required pruning if retained. Asymmetrical form due to competition from larger ash trees. At the time of inspection, there were visible fungal fruiting bodies (possibly Ganoderma sp.), in the upper canopy. The fungus is located on the southside, in a scaffold limb, at approximately 12ft. Depressed lesions are also visible on the main trunk. There is a deep bark seem on the east side, from ground level to 2ft., indicative of internal decay. Woodpecker holes, and mistletoe are also present in canopy. Tree no. 398 has had 1/3 of the whole tree fail on the east side, from ground to 7ft. The remaining canopy is codominant with inclusions at approximately 12 -15ft. The form is very asymmetrical-recommend removal. This is a large specimen with bulbous growths at the base. Overall tree appears to be in good health. Tree no. 400 is a large, lush, old oak tree. It has multiple trunks from base to 8ft., with fair union. Overall condition is typical for mature species. Tree no. 390 has sparse canopy, and small codominant top forming at the tip. Trunk has evidence of irrigation damage. Tree no. 391 is a large sprawling tree growing in a small grove. There is a high amount of root damage on the east side, next to the car path. The lower canopy has a large amount of deadwood and the upper canopy has included unions starting at 18ft. Recommend prunning if tree is to be retained. Tree no. 392 is actively splitting between 6-12ft. Hazardous- Recommend removal Tree no. 393 recently impacted by an adjacent, large tree failure. Failure has compromised the canopy, snapping several scaffold limbs and central leader, leaving the overall form asymmetrical. Tree has failed and is half dead with a large wound at approximately 5ft. The canopy is swamped by larger, adjacent trees. Overall poor specimen, recommend removal. Tree has several scaffold limb failures with a young tree growing in the hollow center of the trunk (at point of past failure). The structure is severely compromised by previous failures, and subsequent decay. Mistletoe visible in canopy. Trees no. 377-385 All grow in a grove located between #18 green and the main driveway. All appear to be the same age and have been heavily pruned. Vigor appears good, form compromised by pruning and past branch failures. All trunk bases are bulbous and gnarled in appearance. Tree no. 386 is a redwood growing on the corner of the cart path. Overall condition is good, typical of healthy species. Trees no. 387-388 have asymmetrical form due to competition with adjacent ash trees. Trees no. 387-388 have asymmetrical form due to competition with adjacent ash trees. Tree no. 389 has lost the top at approx. 30ft. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 365 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 401 47.50 na na Quercus douglasii blue oak 55/40 50/40/50 40%-Poor Large Protected Moderate Retain $63,289.43 402 43.00 na na Sequoia sempervirens coast redwood 60/40 90/90/90 90%-Excellent Protected Moderate Retain $49,526.33 403 24.00 na na Calocedrus decurrens Incense cedar 40/15 65/60/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $13,393.24 404 40.00 na na Sequoia sempervirens coast redwood 45/35 90/50/70 50%-Fair Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$26,454.79 405 47.00 na na Sequoia sempervirens coast redwood 65/35 80/90/70 70%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$51,133.79 406 26.00 na na Quercus agrifolia coast live oak 40/50 60/30/80 30%-Poor Large Protected Low Retain $10,478.97 407 32.00 na na Sequoia sempervirens coast redwood 60/20 70/70/90 70%-Good Photo Protected Low Remove 4, 10 (3x)24-in. $23,703.49 408 40.00 na na Quercus douglasii blue oak 40/65 90/90/95 90%-Excellent Large Protected Low Retain $126,228.23 409 43.50 na na Sequoia sempervirens coast redwood 55/30 70/70/70 70%-Good Photo Protected Moderate Remove 4, 10 (4X) 24-in. or (2x) 36-in.$43,801.68 410 30.50 na na Quercus agrifolia coast live oak 40/40 85/70/65 65%-Good Large Protected Low Retain $31,243.80 411 17.00 17.00 34.00 Schinus molle California pepper 25/30 75/60/70 60%-Fair Protected Moderate Retain $17,919.66 412 17.00 17 & 10.5 44.50 Schinus molle California pepper 30/40 75/60/70 60%-Fair Protected Moderate Retain $21,337.73 413 38.00 na na Sequoia sempervirens coast redwood 60/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$42,975.80 414 26.00 na na Sequoia sempervirens coast redwood 50/20 80/90/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $17,883.43 415 36.50 na na Sequoia sempervirens coast redwood 60/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$39,649.94 416 27.00 na na Sequoia sempervirens coast redwood 50/20 80/80/90 80%-Good Protected Low Retain $19,285.54 Large, sprawling mature tree with multiple failures, growing next to cart path. The form is asymmetrical due to age and limb drop and the upper canopy has been speckled with woodpecker hollows on the under sides of the scaffold limbs. Good health, structure and form-typical for species. Good health, structure and form-typical for species. Multiple tops and thin canopy coverage. Large, sprawling, mature tree growing in lawn area on slope. A majority of the foliage is concentrated towards the ends of the branches. Owl box is located on canopy scaffold limb. There are multiple unions with palm and privet volunteers sprouting inside. The growth of foreign material typically indicates a hollow or dead area with soil buildup and moisture. Tree has multiple tops, in upper canopy, Overall form is slightly asymmetrical. Codominant at approximately 8ft. with included bark. U+nion is poor, with reaction wood and visible seems in bark-indicative of internal decay and cracking. Small, squat tree with a twin trunk from ground level-union is fair. Tree is growing beneath canopy of coast live oak. Hollows with associated decay on larger scaffold limbs. Tree is typical for species of this age. Codominant structure from ground level. There are several large, scaffold branch failures and associated decay throughout. Good health, structure and form-typical for species. Healthy, mature specimen. Tree no. 403 stands alone in a lawn area, has a sweeping lean to the south, that has self corrected. Significant amount of small deadwood. Top of tree no. 404 appears to have been lost and regrown. The lower scaffold limbs appear to be lush, green and dense. Overall tree appears healthy. Tree no. 405 is a large tree with thinning canopy, likely due to branch failures on the south side. It is also next to a cart path that was repaired. Cart path damage was likely caused by large eucalyptus that failed during storm in recent years. Tree is located on a slope, close to the pond by the pool house. There is decay evident from 3ft up to approximately 7ft. where the union of 3 main trunks originate. Borer activity noted on lower trunk. Foliage appears slightly thin. Top of tree, at approximately 70ft, has a small codominant leader. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 366 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 417 27.00 na na Sequoia sempervirens coast redwood 45/30 60/80/80 60%-Fair Protected Low Retain $14,464.15 418 17.00 na na Sequoia sempervirens coast redwood 35/10 90/90/90 90%-Excellent Photo Protected Low Remove 4, 10 (2x) 24-in. $8,601.11 419 28.00 na na Sequoia sempervirens coast redwood 50/15 80/80/80 80%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $20,740.55 420 28.00 na na Sequoia sempervirens coast redwood 45/20 85/70/85 70%-Good Protected Moderate Retain $18,147.98 421 35.00 na na Sequoia sempervirens coast redwood 55/20 60/60/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $20,254.44 422 17.50 na na Sequoia sempervirens coast redwood 45/10 85/90/85 85%-Excellent Photo Protected High Remove 4, 10 (2x) 24-in. $8,608.14 423 28.50 na na Sequoia sempervirens coast redwood 50/20 80/90/80 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $21,487.90 424 17.00 na na Sequoia sempervirens coast redwood 35/20 90/80/70 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $6,020.78 425 12.00 na na Sequoia sempervirens coast redwood 30/15 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $3,857.11 426 14.00 na na Quercus virginiana southern live oak 25/25 85/25/60 25%-Poor Protected Low Retain $4,295.27 427 17.00 9, 6 & 4 36.00 Quercus douglasii blue oak 25/30 70/70/70 70%-Good Large Protected Low Retain $25,894.32 428 39.00 na na Eucalyptus camaldulensis red gum 50/40 80/40/50 40%-Poor Protected Moderate Retain $25,149.54 429 24.00 na na Fraxinus velutina Modesto ash 45/40 40/10/50 10%-Very Poor Photo Protected Low HR 1 (4X) 24-in. or (2x) 36-in.$1,904.74 430 15.00 na na Fraxinus velutina Modesto ash 40/20 20/20/20 20%-Very Poor Photo Protected Low HR 1 (3x)24-in. $1,488.08 431 29.00 16 & 14 59.00 Cupressus arizonica Arizona cypress 40/25 50/40/50 40%-Poor Large Protected Low Retain $45,336.97 432 27.00 na na Sequoia sempervirens coast redwood 60/30 80/90/90 80%-Good Protected Moderate Retain $17,356.98 The top is missing from main leader and canopy is thin/sparse. Young healthy tree, typical for species. There is a small codominant top that can be corrected with pruning. Tree has a small codominant top and several branches that have died back or been removed from the main trunk, on the southeast side, at approx. 35ft. Good condition overall. Good health, structure and form-typical for species. Young tree that appears healthy, growing on a slope, adjacent to the cart path and pond. Lost a main scaffold limb at approx. 10ft., on the north side. A majority of scaffold limbs have included bark and are growing out to the south. Poor structure, yet foliage appears healthy and vigorous. Small multi-trunk tree on slope close to pond. Half of the canopy has died back. There are cankers and woodpecker activity noted throughout. The form is good but, structure is somewhat compromised. Could possibly be two different trees. Central leader lost heavy weight on lateral branches. Structure is codominant, could benefit from pruning to prevent lateral branches competing for dominance. Tree has had multiple branch failures, is full of mistletoe, has large fungal fruiting body in vertical crack on trunk. There are also roots growing inside the cavity left from trunk wound on the east side. This tree is a hazard. Recommend removal. Poor health, structure and form. Codominant structure with included unions between 3-5ft. This is an older tree with broken scaffold limbs throughout. Overall condition is typical of species this age. Tree has a small, codominant, secondary leader at approximately 30ft. and minor irrigation damage to the trunk. There is a void of branches, mid trunk on southeast side. Canopy appears thin, large codominant top at approximately 50ft. The form is asymmetrical with majority of growth to the west side. Young healthy tree, typical for species-good condition overall. Large tree at the end of a group. Tree appears healthy overall. Small amount of broken branches in the lower canopy on the southeast side. Young, healthy tree. Codominant leader that can be corrected with pruning. Young, healthy tree- typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 367 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 433 28.00 na na Catalpa bignoniodes Southern catalpa 30/30 80/70/70 70%-Good Protected Moderate Retain $17,014.38 434 31.00 na na Sequoia sempervirens coast redwood 60/30 80/80/90 80%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$22,880.74 435 34.00 na na Sequoia sempervirens coast redwood 55/25 80/80/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $27,523.56 436 36.00 na na Sequoia sempervirens coast redwood 55/30 85/70/90 70%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$29,999.73 437 37.00 na na Sequoia sempervirens coast redwood 55/30 85/90/90 85%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$38,480.14 438 34.00 na na Sequoia sempervirens coast redwood 55/30 85/90/90 85%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$32,493.09 439 20.00 na na Sequoia sempervirens coast redwood 40/20 85/80/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $10,581.91 440 29.00 na na Sequoia sempervirens coast redwood 45/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$22,526.58 441 16.00 na na Sequoia sempervirens coast redwood 30/15 90/90/90 90%-Excellent Protected Moderate Retain $6,857.08 442 21.00 na na Sequoia sempervirens coast redwood 40/15 90/80/90 80%-Good Protected Moderate Retain $10,499.90 443 11.00 na na Sequoia sempervirens coast redwood 20/12 90/90/90 90%-Excellent Protected Low Retain $3,241.04 444 8.00 na na Sequoia sempervirens coast redwood 15/12 90/90/90 90%-Excellent Protected Low Retain $1,714.27 445 8.00 na na Sequoia sempervirens coast redwood 15/12 90/90/90 90%-Excellent Protected Low Retain $1,714.27 446 4.30 na na Sequoia sempervirens coast redwood 15/12 90/90/90 90%-Excellent Protected Low Retain $495.26 447 18.50 na na Sequoia sempervirens coast redwood 30/20 90/90/90 90%-Excellent Protected Low Retain $9,167.33 448 26.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Low Retain $18,106.98 Low, squat shaped tree -topped below power lines. Form is broad due to location and maintenance pruning. Tree has some tip dieback on the west side. The top has small codominant top that could be corrected. Good health, structure and form-typical for species. Codominant leader at approximately 40ft. - Recommend pruning to remove second leader. Healthy tree, good structure and form, typical for species. Trees no. 444-446 are all healthy trees, good structure and form-typical for species. Close to the current ball netting and pond. Trees no. 444-446 are healthy trees, with good structure and form, typical for species. Close to the current ball netting and pond. Trees no. 444-446 are healthy trees, with good structure and form, typical for species. Close to the current ball netting and pond. Trees no. 447-450 are all healthy trees with good structure and form. Located on the side of the cart path that leads to the shop. Trees no. 447-450 are all healthy trees with good structure and form. Located on the side of the cart path that leads to the shop. Healthy tree, good structure and form, typical for species. Healthy tree, good structure and form, typical for species. Minor, codominant top that could be corrected with pruning. Healthy tree, good structure and form, typical for species. Healthy tree, good structure and form, typical for species. Healthy tree, good structure and form, typical for species. Small codominant top that could be corrected with pruning. Healthy tree, good structure and form, typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 368 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 449 18.00 na na Sequoia sempervirens coast redwood 35/15 90/90/90 90%-Excellent Protected Low Retain $8,678.49 450 23.00 na na Sequoia sempervirens coast redwood 45/15 90/90/90 90%-Excellent Protected Moderate Retain $14,169.51 451 34.00 na na Quercus douglasii blue oak 40/30 60/50/50 50%-Fair Large Protected Low Retain $45,599.95 452 9.50 na na Sequoia sempervirens coast redwood 15/10 90/90/90 90%-Excellent Protected Low Retain $2,417.39 453 6.70 na na Crataegus laevigata hawthorn 10/10 90/90/90 90%-Excellent Photo Protected Low Remove 4, 10 (2x) 24-in. $3,416.09 454 11.00 na na Sequoia sempervirens coast redwood 15/10 90/90/90 90%-Excellent Protected Low Retain $3,241.04 455 11.00 na na Sequoia sempervirens coast redwood 15/10 90/90/90 90%-Excellent Protected Low Retain $3,241.04 456 42.00 na na Sequoia sempervirens coast redwood 75/30 60/80/85 60%-Fair Protected High Retain $31,499.71 457 46.00 na na Eucalyptus globulus Eucalyptus 60/35 80/30/50 30%-Poor Protected Moderate Retain $50,081.05 458 32.00 na na Eucalyptus camaldulensis red gum 80/35 80/80/80 80%-Good Protected Low Retain $38,096.34 459 30.50 na na Eucalyptus camaldulensis red gum 45/25 60/10/10 10%-Very Poor Photo Protected Moderate Remove 1, 4, 10 (3x)24-in. $4,326.06 460 36.00 na na Eucalyptus camaldulensis red gum 50/35 60/60/60 60%-Fair Protected Low Retain $36,161.76 461 27.00 na na Eucalyptus camaldulensis red gum 50/25 60/40/60 40%-Poor Photo Protected Moderate Remove 1, 4, 10 (3x)24-in. $12,053.92 462 21.00 na na Eucalyptus camaldulensis red gum 50/15 50/40/50 40%-Poor Exempt Low Retain $7,291.88 463 26.50 na na Eucalyptus camaldulensis red gum 50/35 50/30/10 10%-Very Poor Protected Low Retain $2,902.90 464 48.00 na na Eucalyptus camaldulensis red gum 50/40 80/50/50 50%-Fair Photo Large Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$47,620.42 Trees no. 447-450 are all healthy trees with good structure and form. Located on the side of the cart path that leads to the shop. Half of the canopy on the west side has been removed, over residence. There is a large hollow in the main trunk that has developed. The canopy is very asymmetrical with ABC lines (aerial bundle cables) that run through scaffold branches. Trees no. 452-455 are all young trees with good health, structure and form-typical for healthy species. Trees no. 452-455 are all young trees with good health, structure and form-typical for healthy species. Trees no. 452-455 are all young trees with good health, structure and form-typical for healthy species. Trees no. 452-455 are all young trees with good health, structure and form-typical for healthy species. Trees no. 447-450 are all healthy trees with good structure and form. Located on the side of the cart path that leads to the shop. Large sized deadwood, half the canopy has failed, leaving only half of a tree. Could benefit from structural pruning if tree is to be retained. Tree is under the size requirement for removal permit. Poor structure, major scaffold limb failures and lateral broken branche. Canopy has a large amount of dead wood and sucker growth. Form is asymetrical, tree is overshadowed by adjacent tree. Significant amount of golf ball damage to the trunk. Twin leaders with large scaffold limb failures throughout the canopy-form is asymmetrical. Tree no. 456 has a sparse canopy with small codominant top forming that could be corrected with pruning. Several large scaffold limbs and central leader have been lost. Structure is codominant with included bark at approximately 15ft. This is a large tree with lateral limbs that are becoming dominant. Possibly E. obliqua-messmate Large tree with a couple of large scaffold limbs that have snapped out and significant golf ball damage to the trunk on the north side. Overall, a nice looking tree. Large amount of decay in the trunk. Every major scaffold limb appears to have failed at some point. Canopy consists of sucker growth only. Recommend removal. Tree no. 460 Twin trunks at approximately 8ft. with fair union. Large scaffold limbs towards top have failed. Large amount of epicormic growth, giving a shaggy appearance to the canopy. Large single trunk tree, growing next to the cart path. Multiple, large, scaffold limb failures, deadwood and sucker growth present. Significant golf ball damage and decay on the trunk. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 369 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 465 22.00 na na Sequoia sempervirens coast redwood 50/15 80/90/70 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $10,083.24 466 21.00 20, 19 & 13 73.00 Eucalyptus camaldulensis red gum 55/40 50/30/30 30%-Poor Large Protected Low Retain $17,001.98 467 18.00 na na Eucalyptus camaldulensis red gum 45/10 50/60/50 50%-Fair Exempt Low Retain $6,696.62 468 19.00 10.00 29.00 Eucalyptus camaldulensis red gum 40/25 60/50/50 50%-Fair Protected Low Retain $9,528.22 469 28.00 na na Eucalyptus camaldulensis red gum 50/40 70/80/70 70%-Good Protected Low Retain $25,521.57 470 32.00 na na Eucalyptus camaldulensis red gum 40/40 30/80/80 30%-Poor Protected Low Retain $12,698.78 471 37.00 na na Quercus douglasii blue oak 50/40 10/50/50 10%-Very Poor Photo Moderate HR 1 (4X) 24-in. or (2x) 36-in.$9,600.36 472 38.00 na na Quercus lobata valley oak 40/40 85/85/75 75%-Good Large Protected Moderate Retain $94,934.15 473 34.00 na na Quercus lobata valley oak 25/40 90/90/90 90%-Excellent Large Protected Low Retain $72,959.92 474 36.00 40.00 76.00 Eucalyptus camaldulensis red gum 60/25 80/60/60 60%-Fair Large Protected Low Retain $71,827.47 475 53.00 na na Eucalyptus camaldulensis red gum 50/20 70/40/50 40%-Poor Large Protected Low Retain $46,446.45 476 37.00 na na Eucalyptus camaldulensis red gum 60/25 70/25/30 25%-Poor Protected Low Retain $14,147.65 477 43.00 na na Eucalyptus camaldulensis red gum 55/30 80/80/80 80%-Good Protected Moderate Retain $61,145.95 478 73.00 na na Eucalyptus camaldulensis red gum 60/25 40/10/40 10%-Very Poor Large Protected Low Retain $19,275.01 479 30.00 na na Eucalyptus camaldulensis red gum 45/30 80/80/80 80%-Good Protected Moderate Retain $29,762.76 480 50.00 na na Eucalyptus camaldulensis red gum 55/30 50/50/70 50%-Fair Photo Large Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$51,671.47 Codominant from ground level. Large scaffold limb failures towards top of tree. Form is asymmetrical due to competition with adjacent trees. Large tree with good branch unions. It has a high amount of dead wood in the canopy and could benefit from pruning to remove it and improve structure. This tree has large scaffold limbs and sparse foliage. Form and structure are good but significant amount of dead limbs throughout. Large, old tree located in the center of the fairway. Canopy shows signs of severe decline, likely receiving too much water (blue oaks like soils to dry out). Superintendent mentioned use of growth regulator around this tree-may be the reason for the recent flush of epicormic sprouts. Large sprawling tree, good overall condition. Appears to have an active beehive in hollow on the east side, scaffold limb. There is also a large hollow on the main trunk, south side. Form is very asymmetrical due to pruning. Small stature tree, low and sprawling in its form. Overhangs cart path leading to the maintenance shop-at very edge of path. Thin form with downward growth. Multi trunk tree with bark inclusions and dieback in canopy. Small central leader that has snapped off-Poor specimen. Large scaffold limb failures throughout. Overall form is tall and thin due to competition from surrounding trees. Tree is under the size requirement for removal permit. Codominant top at approx. 5ft., with large sized deadwood, branch failures throughout and a notable scaffold failure on the west side. Overall the foliage appears sparse. Large, twin trunk tree at the edge of the cart path. Codominant and included from 1-4ft. Canopy is very asymmetrical. Tree has multiple large branch failures throughout, including the whole top of tree-structure is compromised. Main stem failure on the west side at approximately 40ft. A secondary leader has taken over apical dominance. Growing towards the east. Large tree that survived storms were adjacent trees have failed. Evidence of end weight reduction throughout-Form and structure are both good. Tree with multiple large failures at the base and in upper canopy. More than half the tree has failed from ground level leaving a small scaffold branches damaged throughout. Likely a result of adjacent tree failures in recent years storms. Good looking tree that has lost a couple of large scaffold limbs. Other than that, the tree appears to be healthy, with good structure and form. Typical of species left alone. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 370 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 481 72.50 na na Eucalyptus camaldulensis red gum 70/40 80/70/60 60%-Fair Large Protected High Retain $146,663.00 482 17.50 na na Calocedrus decurrens Incense cedar 35/10 40/85/85 40%-Poor Photo Protected High Remove 1, 4, 10 (2x) 24-in. $6,329.75 483 32.00 na na Sequoia sempervirens coast redwood 60/30 80/90/90 80%-Good Protected Moderate Retain $27,089.70 484 19.50 18.50 38.00 Eucalyptus camaldulensis red gum 40/30 70/80/80 70%-Good Protected Low Retain $20,906.28 485 28.00 na na Fraxinus uhdei Shamel ash 45/40 20/30/30 20%-Very Poor Protected Low Retain $1,607.13 486 27.00 na na Fraxinus velutina Modesto ash 35/20 10/10/10 10%-Very Poor Protected Low Retain $2,410.69 487 16.00 15 & 11 42.00 Rhus lancea African sumac 25/30 80/40/60 40%-Poor Protected Moderate Retain $21,108.17 488 37.00 na na Fraxinus uhdei Shamel ash 55/40 80/80/80 80%-Good Protected Moderate Retain $27,162.45 489 32.00 na na Sequoia sempervirens coast redwood 60/25 80/90/90 80%-Good Protected Low Retain $24,380.73 490 27.00 na na Fraxinus velutina Modesto ash 40/25 06/06/06 06%-Very Poor Photo Protected Low HR 1 (3x)24-in. $1,446.42 491 13.50 na na Pinus silvestris Scotch pine 30/20 60/20/20 20%-Very Poor Protected Low Retain $3,195.15 492 32.00 na na Casurina sp.Casurina 50/25 40/60/50 40%-Poor Protected Moderate Retain $19,048.17 493 25.50 na na Sequoia sempervirens coast redwood 50/20 80/80/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $17,202.22 494 27.50 na na Sequoia sempervirens coast redwood 45/20 85/85/80 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $20,006.43 495 45.00 na na Eucalyptus camaldulensis red gum 60/30 85/60/50 50%-Fair Protected Moderate Retain $47,085.62 496 22.00 na na Eucalyptus viminalis manna gum 50/20 85/85/80 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $20,007.19 Very poor condition, codominant with included bark. Decay and hollows from previous large failures at main union. Codominant union with included bark. Cracking visible in main trunk with a third stem removed at 4ft. Low, squat tree with a high amount of water sprout/sucker growth. Tree has been heavily pruned for clearance over the course. Large tree with codominant leaders and included bark. Roots are growing out of the main trunk several feet above soil grade. Overall, tree appears healthy. Single trunk tree that appears healthy with good structure and form. Poor condition overall. Hollows, decay, laminated scaffold limbs and mistletoe. Fungal fruiting body present in between inclusion on the west side. Recommend removal. Tree lays on the ground with two lateral limbs taking over apical dominance. Decay forming on top of main trunk lying on the ground. Branches have been repeatedly cut back to provide clearance. Triple trunk tree at one time-third leader removed on north side. Now codominant at approximately 5ft., trunk to the west has suffered major losses in the upper canopy. Single trunk tree that appears to be declining, large amount of deadwood throughout - could be related to too much water. Poor specimen overall. Healthy tree, good structure and form-typical for species. The tree has twin trunks, starting 2ft., from ground level-union appears good. Significant golf ball damage to the trunk. Tree appears to be in decline. Multi trunk tree with branch unions starting at 7ft.-unions appear to have included bark with a dead center in canopy. Trifurcated and included at approximately 10ft. This tree has been heavily pruned to remove branches to the east over the course. Tip dieback and sucker grow throughout. Tree grows above the sand bunker. Good health, strucure and form. Good health and structure,form is slightly asymmetrical due to competition with neighboring Eucalyptus. Codominant structure with included bark at approximately 20-22ft. Lost several large scaffold limbs on the wet side, causing tree form to be asymmetrical. Tree has good health, form, and structure-overall good condition. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 371 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 497 20.50 na na Eucalyptus viminalis manna gum 50/20 80/60/50 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $10,857.47 498 17.00 na na Sequoia sempervirens coast redwood 35/15 95/95/95 95%-Excellent Protected Moderate Retain $7,263.16 499 28.50 na na Sequoia sempervirens coast redwood 50/15 60/90/90 60%-Fair Protected Moderate Retain $14,504.33 500 29.50 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Moderate Retain $20,720.05 501 26.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Moderate Retain $16,095.09 502 24.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $13,714.16 503 22.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Moderate Retain $11,523.70 504 21.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Moderate Retain $10,499.90 505 13.40 na na Sequoia sempervirens coast redwood 35/15 90/90/90 90%-Excellent Protected Moderate Retain $4,275.20 506 24.00 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Moderate Retain $13,714.16 507 32.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Moderate Retain $24,380.73 508 33.00 na na Sequoia sempervirens coast redwood 55/20 90/90/90 90%-Excellent Protected Low Retain $25,928.34 509 5.00 4 & 3 12.00 Olea europaea olive 15/10 50/60/40 40%-Poor Protected Moderate Retain $930.09 510 6.50 na na Olea europaea olive 15/10 40/60/40 40%-Poor Protected Moderate Retain $785.92 511 8.00 5.50 13.50 Olea europaea olive 20/15 10/60/40 10%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $438.30 512 7.70 na na Olea europaea olive 20/10 50/60/40 40%-Poor Protected Moderate Retain $1,102.90 Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 509-513 are all young olive trees. Tree no. 509 has a thin, wispy canopy. Young, healthy tree typical for species growing in confined space. Canopy is sparse and has been raised to approximately 20ft. Small decay spot at the base on the east side. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. This tree has a small codominant top that can be corrected with pruning. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Trees no. 500-508 are all located in stand along the fencelineat the back of the shop, approximately 1ft. from the cart path. Thin and spindly canopy, lost some larger scaffold limbs on the west side. Trees no. 509-513 are all young olive trees. Tree no. 510 grows on a lean to the West and has a very sparse canopy. Trees no. 509-513 are all young olive trees. Tree no. 511 is 95% dead. Recommend removal Trees no. 509-513 are all young olive trees. Tree no. 512 is a single trunk tree that leans to the West. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 372 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 513 24.00 na na Quercus agrifolia coast live oak 35/35 85/80/80 80%-Good Protected Low Retain $23,810.21 514 23.00 na na Quercus agrifolia coast live oak 35/20 65/50/50 50%-Fair Protected Low Retain $13,667.10 515 26.00 na na Quercus agrifolia coast live oak 40/35 45/80/65 45%-Fair Large Protected Low Retain $15,718.46 516 48.00 na na Eucalyptus camaldulensis red gum 65/40 85/80/80 80%-Good Large Protected Low Retain $85,716.76 517 48.00 na na Eucalyptus camaldulensis red gum 65/40 85/70/80 70%-Good Large Protected Low Retain $75,002.17 518 50.00 na na Eucalyptus camaldulensis red gum 65/50 50/80/95 50%-Fair Large Protected Moderate Retain $58,130.40 519 5.50 na na Lagerstroemia sp.crape myrtle 25/15 90/90/90 90%-Excellent Protected Moderate Retain $2,386.50 520 26.00 na na Sequoia sempervirens coast redwood 45/20 80/90/90 80%-Good Protected Moderate Retain $16,095.09 521 26.00 na na Sequoia sempervirens coast redwood 45/20 80/90/90 80%-Good Protected Moderate Retain $17,883.43 522 25.00 na na Sequoia sempervirens coast redwood 45/20 80/90/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $16,534.24 523 27.00 na na Sequoia sempervirens coast redwood 45/20 80/90/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $17,356.98 524 7.50 6.00 na Olea europaea olive 15/10 80/70/70 70%-Good Protected Moderate Retain $1,831.11 525 37.00 na na Sequoia sempervirens coast redwood 50/30 85/60/90 60%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$27,162.45 526 34.00 na na Sequoia sempervirens coast redwood 50/25 85/90/90 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $32,493.09 527 36.00 na na Sequoia sempervirens coast redwood 45/30 85/80/90 80%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$34,285.40 528 39.00 na na Sequoia sempervirens coast redwood 50/25 85/90/90 85%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $42,752.59 Healthy tree with good structure and form-typical for species. Healthy tree with good structure and form-typical for species. Twin trunk tree from ground level-union is fair. Overall good health, vigor and form. Trees no. 525-528 all appear to be healthy and vigorous. Typical for species-growing in small grove. Located near creak/pond. This tree has a codominant leaders at 25ft. and again at 50ft. Trees no. 525-528 all appear to be healthy and vigorous. Typical for species-growing in small grove. Located near creak/pond. Trees no. 525-528 all appear to be healthy and vigorous. Typical for species-growing in small grove. Located near creak/pond. Large tree with a codominant union at 7ft. Overall condition is typical of healthy species. Large tree with included bark between codominant union at 10ft. The tree has been heavily reduced over the fairways. Large sprawling canopy tree, foliage appears thin. It consists of twin trunks at approximately 18ft. Recommend removal of small branch growing out of that union, to avoid long-term problem. Young healthy tree with good structure and form. Notable irrigation impact damage to the trunk. Multiple leaders forming at the very tip of the tree-could be corrected with pruning. Trees no. 509-513 are all young olive trees. Tree no. 513 appears to be a healthy looking tree growing together with two other oaks in a small grove. This particular tree is codominant with good union at 8ft. Tree no. 514 is codominant at 5ft. with included bark. This is the center tree within a group of three trees. There are hollows and decay at the base on the north side and black staining on the bark. Overall, the canopy appears healthy. The form is fair but structure may be compromised by unseen, interior decay. Tree no. 515 does not appear as healthy as 513 and 514. The foliage is much thinner and there is a small decay patch at the base on the west side. The structure is codominant at 7ft and then again between 8-9ft.-good unions. Trees no. 525-528 all appear to be healthy and vigorous. Typical for species-growing in small grove. Located near creak/pond. Small hanger in canopy at time of inspection. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 373 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 529 29.00 na na Sequoia sempervirens coast redwood 50/20 50/90/90 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $12,514.77 530 27.00 na na Sequoia sempervirens coast redwood 50/20 50/90/80 50%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $10,848.12 531 34.00 na na Eucalyptus camaldulensis red gum 50/35 60/60/60 60%-Fair Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$34,047.36 532 25.50 22 & 22 66.50 Eucalyptus camaldulensis red gum 60/30 60/30/60 30%-Poor Large Protected Moderate Retain $23,830.94 533 29.00 na na Eucalyptus camaldulensis red gum 50/30 60/40/45 40%-Poor Protected Moderate Retain $13,905.82 534 58.00 na na Eucalyptus camaldulensis red gum 65/50 60/60/70 60%-Fair Large Protected Moderate Retain $83,434.95 535 69.00 na na Eucalyptus camaldulensis red gum 65/60 45/20/40 20%-Very Poor Photo Large Protected High HR 1 (10x) 24-in. or (5x) 36-in. $39,361.26 536 40.00 na na Eucalyptus camaldulensis red gum 65/30 70/40/70 40%-Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$23,148.82 537 40.00 na na Eucalyptus camaldulensis red gum 65/40 70/30/40 30%-Poor Photo Protected Moderate HR 1 (4X) 24-in. or (2x) 36-in.$17,361.61 538 50.00 na na Eucalyptus camaldulensis red gum 65/40 40/06/30 06%-Very Poor Photo Large Protected Moderate Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$6,975.65 539 83.00 na na Eucalyptus camaldulensis red gum 95/60 70/60/70 60%-Fair Photo Large Protected High HR 1 (10x) 24-in. or (5x) 36-in. $192,220.95 540 65.00 na na Eucalyptus camaldulensis red gum 95/50 80/80/80 80%-Good Large Protected High Retain $157,184.60 541 40.50 na na Eucalyptus camaldulensis red gum 55/30 60/20/30 20%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$13,560.66 542 26.00 na na Sequoia sempervirens coast redwood 55/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$20,118.86 543 25.00 na na Sequoia sempervirens coast redwood 55/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$18,601.02 544 48.50 na na Eucalyptus camaldulensis red gum 70/60 70/30/60 30%-Poor Large Protected Moderate Retain $32,816.94 Single trunk tree from ground to 20ft. Very upright form with included unions. Golf ball damage to bark on trunk. Several large, lower scaffold limbs have been removed to provide clearance. Noted hollow on north side at base. Top of north side of canopy has snapped out at approximately 40ft -compromising structure and form. Form is tall and narrow. Significant amount of epicormic growth. Young tree-typical for species, good condition Young tree-typical for species, good condition Large, old tree with significant size scaffold limbs that have failed or been removed throughout. Structure is poor but form is good. Significant amount of epicormic growth around points of failure on east side. Large single trunk tree from ground to 5.5ft. Canopy has been raised to provide clearance, leaving multiple large wounds on the main trunk. Evidence of golf ball damage. Some deadwood throughout and two stems have been removed at the base on the north and east side-Tree is most likely hollow at base. Large sprawling tree with multiple main leaders and included bark between the unions. Several torn branches at 4ft. and old wounds in the main stem between 7-10ft. on the east side- leaving multiple decay spots around base-likely indication of hollow center. Canopy has been heavily raised due to location. Considered hazardous-recommend removal. Branch failures at 6ft. on the north side leaving large wound with plants growing out of the hollow. The upper canopy health and form appear good. Large tree with multiple trunks and included bark. Evidence of large trunks either failed or removed on both southeast and north side of tree. Canopy has been heavily raised due to location beside the Tee. Consider removal due to structure and location. Large tree with a crack opening up between two main stems, at the point of inclusion. Significant amount of decay from large scaffold limb loss throughout the main canopy. Large decay pocket in central leader within canopy. Large multi trunk, sprawling tree with a significant amount of decay all around the base - likely caused by mechanical damage. Several large scaffold limbs have failed or been renmoved on the West side. Plants growing between leaders where debris has built up. Consider removal due to structure and location. Good structure and form, canopy appears sparse. Trunk slightly bent, brown flagging of foliage in the canopy. Canopy appears sparse, decay at base from a trunk wound on the southwest side, bark damaged due to golf ball impact and a secondary 12in. round trunk wound with decay on the main trunk at approximately 9–10 feet . Tree has been pruned for clearance due to its location, in front of the tee. Three main leaders between 2-5ft., fourth stem removed on the west side. Tree has been heavily pruned due to location, in front of the tee. Large amount of epicormic regrowth. Center of unions have hollows that have filled with water, soil and debris. Tree has lost top on the north side. The majority of the canopy is growing to the east. Large sized deadwood within the canopy and trunk appears slightly buried. Several large branch failures throughout the canopy were noted. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 374 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 545 39.00 na na Eucalyptus camaldulensis red gum 50/40 45/10/20 10%-Very Poor Photo Protected Moderate Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$7,073.31 546 43.00 na na Eucalyptus camaldulensis red gum 60/45 80/80/80 80%-Good Protected Moderate Retain $68,789.19 547 32.00 na na Eucalyptus camaldulensis red gum 50/40 40/20/40 20%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$9,524.08 548 34.00 na na Eucalyptus camaldulensis red gum 55/40 50/50/65 50%-Fair Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$26,879.50 549 29.00 na na Eucalyptus camaldulensis red gum 70/30 30/10/30 10%-Very Poor Photo Protected High Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$3,911.01 550 26.00 na na Eucalyptus camaldulensis red gum 50/50 30/30/30 30%-Poor Photo Protected High Remove 1, 4, 10 (6x)24-in. or (3x)36-in.$9,431.08 551 36.00 na na Eucalyptus camaldulensis red gum 65/35 80/70/70 70%-Good Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$42,188.72 552 39.00 na na Eucalyptus camaldulensis red gum 65/45 20/20/45 20%-Very Poor Photo Protected Moderate HR 1 (6x)24-in. or (3x)36-in.$14,146.61 553 43.00 na na Eucalyptus camaldulensis red gum 70/65 70/70/70 70%-Good Protected Moderate Retain $60,190.54 554 28.00 na na Eucalyptus camaldulensis red gum 50/35 20/20/50 20%-Very Poor Protected Moderate Retain $7,291.88 555 39.00 na na Eucalyptus camaldulensis red gum 55/40 80/80/80 80%-Good Protected Moderate Retain $56,586.46 556 15.00 12.00 27.00 Rhus lancea African sumac 20/25 70/40/50 40%-Poor Protected High Retain $12,938.39 557 13.00 10.5 & 9.5 33.00 Rhus lancea African sumac 20/25 70/40/50 40%-Poor Protected High Retain $11,660.33 558 12.50 9.50 22.00 Rhus lancea African sumac 20/25 70/40/50 40%-Poor Protected Moderate Retain $8,643.13 559 19.00 na na Pinus canariensis Canary Island pine 60/25 40/20/30 20%-Very Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $3,357.61 560 37.00 na na Sequoia sempervirens coast redwood 70/25 80/80/80 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $36,216.60 Top of tree has failed causing asymmetrical form and associated decay. Significant sized dead wood throughout remainder of canopy. Tree no. 556–558 all grow together in a group of three. Individually they have poor structure and benefits from being in a group. There have been multiple large limbs removed, and the canopies exists primarily of epicormic growth. Tall slender form with a trunk wound, possibly a canker or branch/stem failure, at approximately 25ft. on the east side and approximately 30ft. on the west side. Tree is a good candidate for failure-grows with heavy lean. Branches and majority of weight are in the top half of the tree. Single trunk tree from ground level with a codominant top starting at approximately 60ft. Form is very narrow. Large, old tree with codominant structure at approx. 12ft-union appears fair. There is a large amount of wounding and associated decay in the main trunk, from ground level to 10ft. Wounds are noted all the way around the circumference of the trunk. It appears to be some type of canker. There are also large branch failures throughout the upper canopy. Recommend removal. Large tree with codominant structure starting at approximately 20ft.=union appears to be good. Very heavy end weight throughout the canopy, tree would benefit from structure pruning. Small stature tree due to large failures on lower main trunk where main scaffold limbs originate -north side. Large single trunk tree with large scaffold limbs that have been removed or failed on north side. Overall tree appears to be in good condition. Tree no. 556–558 all grow together in a group of three. Individually they have poor structure and benefits from being in a group. There have been multiple large limbs removed, and the canopies exists primarily of epicormic growth. Tree no. 556–558 all grow together in a group of three. Individually they have poor structure and benefits from being in a group. There have been multiple large limbs removed, and the canopies exists primarily of epicormic growth. Large tree with well developed structure and form. Possible stress crack noted on the lower portion of the main trunk, west side, below where the scaffold branch starts. Large, multi trunk tree, with poor structure. Several large limb failures and large size deadwood throughout. Soil buildup on the east side of the root zone. Secondary trunk removed from base, multiple failures and tip dieback throughout canopy. Large area of soil buildup on the east side of root zone. Twin trunk tree with included bark and associated decay. Leader on the west side of canopy has multiple failures leaving behind a tall skinny trunk. Large area of soil buildup on the east side of root zone. Codominant at 10ft.. Trunk failure on north side, large limb removed at 4.5ft.-leaving a 3ft. long decay patch. Tree has been pruned for clearance on the west side, over the fairway. Large area of soil buildup on the east side of root zone. Large, tree with multiple trunks starting at approximately 5ft.–8ft.-unions appear good. Some large stems have been removed from the upper canopy. Overall form and structure are good. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 375 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 561 28.00 na na Sequoia sempervirens coast redwood 50/15 70/90/90 70%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $18,147.98 562 41.00 na na Sequoia sempervirens coast redwood 60/20 80/80/80 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $44,470.49 563 40.00 na na Quercus douglasii blue oak 55/60 50/50/50 50%-Fair Protected High Retain $63,114.12 564 41.00 na na Sequoia sempervirens coast redwood 65/20 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $40,023.44 565 35.00 na na Pinus canariensis Canary Island pine 60/20 80/60/75 60%-Fair Photo Protected High Remove 4, 10 (3x)24-in. $34,180.67 566 35.70 na na Sequoia sempervirens coast redwood 50/20 70/50/80 50%-Fair Protected Moderate Retain $21,072.72 567 35.70 na na Sequoia sempervirens coast redwood 65/20 70/90/90 70%-Good Protected Moderate Retain $26,551.63 568 56.00 na na Sequoia sempervirens coast redwood 70/35 70/95/90 70%-Good Large Protected Low Retain $72,591.93 569 35.50 na na Sequoia sempervirens coast redwood 50/25 70/95/90 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $29,172.19 570 31.00 na na Sequoia sempervirens coast redwood 50/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$25,740.84 571 20.00 na na Sequoia sempervirens coast redwood 40/30 90/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$11,904.65 572 14.50 na na Sequoia sempervirens coast redwood 30/25 90/90/90 90%-Excellent Protected Moderate Retain $6,257.38 573 17.00 na na Sequoia sempervirens coast redwood 35/25 90/90/90 90%-Excellent Protected High Retain $7,741.00 574 26.00 na na Sequoia sempervirens coast redwood 50/30 90/90/90 90%-Excellent Protected Moderate Retain $20,118.86 575 24.50 na na Sequoia sempervirens coast redwood 50/30 90/90/90 90%-Excellent Protected High Retain $16,077.98 576 32.50 na na Sequoia sempervirens coast redwood 55/30 70/90/90 70%-Good Protected Moderate Retain $22,005.01 Slightly sparse canopy otherwise appears healthy with structure and form typical for species. Relatively young tree with a slightly sparse canopy and codominant leader with included bark at approximately 4ft. This secondary leader should be removed. Large, old sprawling tree with majority of the weight in scaffold limbs to the Southeast. Large branch failures have occurred in the upper canopy to the West. The large remaining limb to the West has significant amount of decay and will most likely fail. The lower scaffold limbs have been removed at approximately 5–6ft. and now have decay setting in. Overall, this tree has a high probability of falling apart with time. Consider removal due to location and current overall condition. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appear to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appeared to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appeared to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appeared to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appeared to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appeared to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appear to be in good condition, typical for species. Tree no. 575 has a small codominant top that can be corrected with pruning. Large single trunk tree, good condition- typical for species. Codominant structure starting at 10ft and again at approx. 30ft. Both unions appear to have included bark. Recommend pruning to remove or reduce both codominant stems. Overall, tree appears to be a healthy, good specimen. Canopy appears stressed and thin. Multiple leaders starting at approx. 45ft. with included bark betweeen unions. Structure and form are compromised- resembles a large pitchfork. Slightly sparse canopy, structure and form are good. Slightly sparse canopy, structure and form are good. Small codominant top could be corrected with pruning. Slightly sparse canopy, structure and form are good. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 376 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 577 23.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Moderate Retain $15,743.90 578 27.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected Moderate Retain $19,526.61 579 19.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Protected Moderate Retain $10,743.95 580 21.00 na na Sequoia sempervirens coast redwood 40/20 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $11,812.39 581 17.00 na na Sequoia sempervirens coast redwood 35/15 90/90/90 90%-Excellent Protected Moderate Retain $8,601.11 582 17.00 na na Sequoia sempervirens coast redwood 30/15 90/90/90 90%-Excellent Protected Moderate Retain $8,601.11 583 27.00 na na Sequoia sempervirens coast redwood 45/25 90/80/90 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $19,285.54 584 32.00 na na Sequoia sempervirens coast redwood 50/20 90/80/90 80%-Good Protected Moderate Retain $27,089.70 585 20.00 na na Pinus canariensis Canary Island pine 45/20 95/90/80 80%-Good Photo Protected High Remove 4, 10 (3x)24-in. $14,881.38 586 28.00 na na Sequoia sempervirens coast redwood 50/25 90/90/90 90%-Excellent Protected Moderate Retain $20,999.81 587 35.00 na na Sequoia sempervirens coast redwood 55/25 90/90/90 80%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $29,166.40 588 28.50 na na Sequoia sempervirens coast redwood 50/20 90/80/90 80%-Good Protected Moderate Retain $19,339.11 589 31.50 na na Sequoia sempervirens coast redwood 50/20 90/80/90 80%-Good Protected Moderate Retain $26,249.76 590 33.00 na na Sequoia sempervirens coast redwood 50/25 90/80/90 80%-Good Protected Moderate Retain $28,809.26 591 26.50 na na Sequoia sempervirens coast redwood 50/25 90/90/90 80%-Good Photo Protected Moderate Remove 4, 10 (3x)24-in. $16,720.09 592 36.00 na na Sequoia sempervirens coast redwood 50/20 90/80/90 80%-Good Protected High Retain $34,285.40 Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appear to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appear to be in good condition, typical for species. Tree no. 570-582 are all growing in an open grove. These are young, healthy trees that appear to be in good condition, typical for species. Trees no. 580–582 grow together in a smaller group. These are young, healthy trees that appear to be in good condition, typical species. Trees no. 580–582 grow together in a smaller group. These are young, healthy trees that appear to be in good condition, typical species. Trees no. 583-594 all grow together in a grove. Tree no. 588, 589 and 590 all have small codominant tops that can be corrected with pruning. Trees no. 583-594 all grow together in a grove. Tree no. 588, 589 and 590 all have small codominant tops that can be corrected with pruning. Trees no. 583-594 all grow together in a grove. Tree no. 588, 589 and 590 all have small codominant tops that can be corrected with pruning. Trees no. 583-594 all grow together in a grove. Tree no 591 is a young healthy tree- typical species. Trees no. 583-594 all grow together in a grove. Tree no. 592 and 593 have small codominant tops that can be corrected with pruning. Trees no. 580–582 grow together in a smaller group. These are young, healthy trees that appear to be in good condition, typical species. Trees no. 583-594 all grow together in a grove. Tree no. 583 has a codominant top with an included union at approximately 20ft., that can be corrected with pruning. Trees no. 583-594 all grow together in a grove. Tree no. 584 has multiple tops forming, this can be corrected with pruning. Trees no. 583-594 all grow together in a grove. Tree no. 585 is a young healthy tree, good condition typical for species. A majority of the growth in the canopy to the South, due to competition with adjacent redwood tree. Trees no. 583-594 all grow together in a grove. Tree no. 586 and 587 are both young, healthy trees typical for species. Trees no. 583-594 all grow together in a grove. Tree no. 586 and 587 are both young, healthy trees typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 377 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 593 34.50 na na Sequoia sempervirens coast redwood 50/20 90/80/90 80%-Good Protected Moderate Retain $28,339.03 594 24.00 na na Sequoia sempervirens coast redwood 45/25 90/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $15,428.43 595 37.00 na na Pinus canariensis Canary Island pine 50/25 85/60/85 60%-Fair Protected High Retain $38,198.65 596 24.00 na na Sequoia sempervirens coast redwood 50/20 90/90/90 90%-Excellent Protected High Retain $15,428.43 597 24.00 na na Sequoia sempervirens coast redwood 45/25 90/90/90 90%-Excellent Protected High Retain $15,428.43 598 35.50 na na Sequoia sempervirens coast redwood 50/20 95/90/90 90%-Excellent Protected High Retain $33,756.39 599 24.50 na na Sequoia sempervirens coast redwood 45/20 95/90/90 90%-Excellent Protected High Retain $16,077.98 600 25.00 na na Sequoia sempervirens coast redwood 45/20 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $16,740.92 601 23.00 na na Sequoia sempervirens coast redwood 50/20 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $14,169.51 602 23.00 na na Sequoia sempervirens coast redwood 50/20 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $14,169.51 603 23.50 na na Sequoia sempervirens coast redwood 50/30 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$14,792.28 604 25.00 na na Sequoia sempervirens coast redwood 50/25 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $16,740.92 605 26.50 na na Sequoia sempervirens coast redwood 50/20 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $18,810.10 606 50.00 na na Sequoia sempervirens coast redwood 65/25 95/90/95 90%-Excellent Photo Large Protected High Remove 4, 10 (3x)24-in. $66,963.68 607 25.00 na na Sequoia sempervirens coast redwood 50/25 95/90/90 90%-Excellent Photo Protected High Remove 4, 10 (3x)24-in. $18,601.02 608 22.00 na na Sequoia sempervirens coast redwood 50/20 95/90/90 90%-Excellent Protected Moderate Retain $14,404.63 Trees no. 583-594 all grow together in a grove. Tree no. 594 is a young, healthy tree -typical for species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Tree no. 595 has lost its top at approximately 50ft. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 583-594 all grow together in a grove. Tree no. 592 and 593 have small codominant tops that can be corrected with pruning. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Tree no. 606 has a small codominant top that could be easily corrected with pruning. This tree stands out of the grove, alone. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 378 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 609 19.00 na na Sequoia sempervirens coast redwood 45/25 95/90/90 90%-Excellent Protected Moderate Retain $9,669.55 610 21.00 na na Sequoia sempervirens coast redwood 48/20 95/90/90 90%-Excellent Photo Protected Moderate Remove 4, 10 (3x)24-in. $13,124.88 611 21.00 na na Sequoia sempervirens coast redwood 45/20 95/90/90 90%-Excellent Protected Moderate Retain $11,812.39 612 26.00 na na Sequoia sempervirens coast redwood 50/20 90/80/90 80%-Good Protected Moderate Retain $16,095.09 613 14.00 na na Sequoia sempervirens coast redwood 35/15 90/90/90 90%-Excellent Protected Moderate Retain $5,833.28 614 20.50 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Moderate Retain $11,256.59 615 23.00 na na Sequoia sempervirens coast redwood 48/20 90/90/90 90%-Excellent Protected Moderate Retain $15,743.90 616 32.00 na na Sequoia sempervirens coast redwood 50/25 90/90/90 90%-Excellent Protected Moderate Retain $27,428.32 617 26.50 na na Sequoia sempervirens coast redwood 45/20 90/90/90 90%-Excellent Protected Moderate Retain $18,810.10 618 28.00 na na Sequoia sempervirens coast redwood 50/30 90/90/90 90%-Excellent Protected Moderate Retain $20,999.81 619 37.00 na na Sequoia sempervirens coast redwood 50/25 90/90/90 90%-Excellent Protected Moderate Retain $36,669.31 620 25.00 13.00 38.00 Fraxinus velutina Modesto ash 25/20 20/10/30 10%-Very Poor Photo Protected Low HR 1 (3x)24-in. $2,625.64 621 12.00 11 & 6 29.00 Olea europaea olive 30/30 80/60/60 60%-Fair Protected Moderate Retain $8,398.68 622 10.00 8.50 18.50 Olea europaea olive 30/30 80/70/70 70%-Good Protected Moderate Retain $6,230.29 623 11.00 na na Olea europaea olive 30/30 80/70/60 60%-Fair Protected Moderate Retain $3,751.35 624 10.00 na na Quercus agrifolia coast live oak 30/10 80/40/20 20%-Very Poor Photo Protected Low HR 1 (2x)24-in. $826.74 Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Tree no. 612 has a small codominant top that could be easily corrected with pruning. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Canopy grows on a heavy lean to the South, struggling for light, decay noted all around the base. Whole tree failure is highly probable. Recommend removal Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Trees no. 595–619 are all growing in a grove. These trees are relatively young and healthy. Overall condition appears good and typical for the species. Tree is 75% dead and exist only as sucker growth. The entire trunk is decayed on the southwest side. Recommend removal. Tree no. 621–623 are growing together in a group. These are all older, large specimens with bulbous bases. There is some decay where branches have been removed. They are largely asymmetrical due to competition with each other. Overall, their condition is typical for the species. Tree no. 621 has mechanical damage to the lateral limb on the west side and large torn out branch on the east side. Tree no. 621–623 are growing together in a group. These are all older, large specimens with bulbous bases. There is some decay where branches have been removed. They are largely asymmetrical due to competition with each other. Overall, their condition is typical for the species. Tree no. 621–623 are growing together in a group. These are all older, large specimens with bulbous bases. There is some decay where branches have been removed. They are largely asymmetrical due to competition with each other. Overall, their condition is typical for the species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 379 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 625 16.50 na na Quercus agrifolia coast live oak 35/35 80/50/70 50%-Fair Protected Low Retain $5,627.02 626 11.50 na na Quercus agrifolia coast live oak 35/10 70/20/20 20%-Very Poor Protected Low Retain $1,093.37 627 23.00 na na Pinus canariensis Canary Island pine 45/30 80/70/70 70%-Good Protected High Retain $17,220.55 628 28.50 na na Sequoia sempervirens coast redwood 50/25 85/50/85 50%-Fair Protected Moderate Retain $13,429.94 629 17.00 na na Sequoia sempervirens coast redwood 40/20 80/85/80 80%-Good Protected Moderate Retain $7,645.43 630 21.00 na na Pinus canariensis Canary Island pine 50/25 40/20/45 20%-Very Poor Protected High Retain $4,101.68 631 17.50 na na Sequoia sempervirens coast redwood 35/15 70/85/70 70%-Good Protected High Retain $7,089.06 632 45.00 na na Sequoia sempervirens coast redwood 55/40 65/80/80 65%-Good Protected High Retain $43,526.39 633 28.00 na na Fraxinus excelsior European ash 25/25 10/45/60 10%-Very Poor Photo Protected High HR 1 (3x)24-in. $5,497.94 634 39.00 na na Sequoia sempervirens coast redwood 55/25 90/90/90 90%-Excellent Protected High Retain $45,267.44 635 37.50 na na Sequoia sempervirens coast redwood 55/25 90/90/90 90%-Excellent Protected Moderate Retain $41,852.30 636 20.50 na na Quercus agrifolia coast live oak 35/35 40/10/70 10%-Very Poor Protected Moderate Retain $2,171.49 637 22.50 na na Sequoia sempervirens coast redwood 40/20 85/30/90 30%-Poor Protected Moderate Retain $5,022.28 638 41.00 na na Sequoia sempervirens coast redwood 55/30 90/80/90 80%-Good Protected Moderate Retain $44,470.49 639 27.50 na na Fraxinus excelsior European ash 30/30 20/20/30 20%-Very Poor Protected Moderate Retain $10,606.68 640 18.00 na na Fraxinus excelsior European ash 25/25 20/20/30 20%-Very Poor Protected Moderate Retain $4,544.22 Codominant from approximately 35ft. Foliage appears sparse, low in vigor, being out competed for canopy space. Young, tree with very asymmetrical form, previously overcrowded by a large ash tree. The ash tree has recently been remove. Large mature redwood that has lost several branches leavine a more open canopy. Tree appears to be dying- 90% dead, in severe decline. Cavity in the center of the unions where grass is starting to grow. Recommend removal. Tree no. 634 and 635 both appear to be good, healthy specimens. Tree no. 634 and 635 both appear to be good healthy looking trees. Large tree, growing close to fenceline, . large codominant unions, could benefit from structure pruning. There is a high amount of sap sucker damage to the bark in the upper canopy. High amount of decay throughout the base. Tree is searching for light, due to competition with other trees- has poor form and structure. Recommend removal Good tree overall, could benefit from structure pruning. Codominant union with included bark at approximately 35ft. Overall good health and form-tree could benefit from structure pruning. Young tree good condition, typical species. Form is slightly asymmetrical due to the competition with adjacent trees. Cdominant structure, with included bark, starting at 10 feet.-poor union. Foliage appears to be stunted (lower foliage impacted by irrigation overspray). Tree is a poor specimen-consider longterm removal. Tree has very poor structure. Codominant and included with very poor union at approximately 20ft. Otherwise the tree appears healthy and vigorous. Small codominant leader at approximately 50ft., could be corrected with pruning. Otherwise, tree appears to be in good condition. Large Ash tree with significant failures and trunk decay from ground to 6ft. Fungal fruiting bodiespresent on trunk where decay has set in on South side. Large amount of deadwood throughout canopy. Canopy consists primarily of sucker growth. Tree appeas to be dying, significant amount of decay throughout and a hollow at the base. Large amount of sucker growth. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 380 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 641 26.00 na na Sequoia sempervirens coast redwood 55/30 90/90/90 90%-Excellent Protected Moderate Retain $20,118.86 642 25.00 na na Fraxinus excelsior European ash 30/30 30/50/60 30%-Poor Photo Protected Moderate HR 1 (4X) 24-in. or (2x) 36-in.$13,148.77 643 18.00 na na Fraxinus excelsior European ash 25/20 10/60/25 10%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $2,272.11 644 12.00 na na Araucaria heterophylla Norfolk Island pine 30/10 80/10/10 10%-Very Poor Photo Protected Moderate HR 1 (2x)24-in. $669.66 645 24.00 na na Fraxinus excelsior European ash 20/10 10/10/10 10%-Very Poor Photo Protected Moderate HR 1 (2x)24-in. $4,039.30 646 19.50 na na Fraxinus excelsior European ash 20/15 10/20/25 10%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $2,666.57 647 20.00 na na Fraxinus excelsior European ash 20/15 10/20/15 10%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $2,805.07 648 26.00 na na Fraxinus excelsior European ash 25/25 50/50/50 50%-Fair Photo Protected Moderate HR 1 (3x)24-in. $23,702.86 649 24.00 na na Sequoia sempervirens coast redwood 50/25 85/90/80 80%-Good Protected Low Retain $15,237.96 650 23.50 na na Fraxinus excelsior European ash 25/30 10/20/20 10%-Very Poor Photo Protected Moderate HR 1 (4X) 24-in. or (2x) 36-in.$3,872.75 651 31.50 na na Sequoia sempervirens coast redwood 50/30 90/90/90 90%-Excellent Protected Low Retain $29,530.98 652 24.00 na na Fraxinus excelsior European ash 35/35 20/20/20 20%-Very Poor Photo Protected Moderate HR 1 (4X) 24-in. or (2x) 36-in.$8,078.61 653 21.00 na na Sequoia sempervirens coast redwood 50/20 80/90/80 80%-Good Protected Low Retain $11,666.56 654 21.50 na na Fraxinus excelsior European ash 35/25 30/30/20 20%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $6,483.22 655 30.00 na na Quercus ilex holly oak 35/40 90/50/65 50%-Fair Large Protected Moderate Retain $39,446.32 656 32.00 na na Sequoia sempervirens coast redwood 60/25 90/90/90 90%-Excellent Protected Low Retain $30,475.91 Form is asymetrical and three of seven main leaders are dead. Recommend removal. Overall condition is good -typical species. Tree is 50% dead recommend removal. Tree is healthy, good structure and form-typical for species. Appears to have suffered major structural damage with 50% of the canopy gone due to large failures. Majority of the canopy is to the north side of the tree, large size deadwood present, form is very asymmetrical. Recommend removal. Tree has grown with heavy competition of surrounding ash trees. Tree is young and will most likely prevail. Tree is 50% dead, has decay at the base and a significant amount of decay present throughout the upper canopy. Appears to be in the process of dying. Consider removal. Tree is 95% dead. Decay and deadwood throughout, fungal fruiting bodies/conk visible at the base on the north side. Recommend removal. Very asymmetrical form, grows on a lean due to competion from former adjacent trees. It has formed an "S" shape trunk with a codominant leader at approximately 15ft. Also appears to have a girdling root, visible on the soil surface. All ash trees in this area appear to be dying. Majority of decay is on the South sides of trunk where it has been exposed to sun, irrigation impact, and golf ball damage. Recommend removal. Tree no. 645-647 are 90% dead. Large amount of decay present on the southside of the trunks. The canopies mostly exist as sucker sprouts. Recommend removal. Tree no. 645-647 are 90% dead. Large amount of decay present on the southside of the trunks. The canopies mostly exist as sucker sprouts. Recommend removal. Tree no. 645-647 are 90% dead. Large amount of decay present on the southside of the trunks. The canopies mostly exist as sucker sprouts. Recommend removal. Single trunk tree, growing on its own, between ash trees. Appears to be good condition. Form is very asymmetrical, majority of the canopy is to the north. Southern portion of the tree has failed/been removed. Decay and hollows present, appears to be unhealthy. Tree has been pruned for fairway clearance. Large amount of mechanical damage on the trunk, from ground level to approximately 10ft. with subsequent decay primarily on the South and West sides. Good health, structure and form-typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 381 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 657 23.00 na na Fraxinus excelsior European ash 25/20 06/10/10 06%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $2,225.82 658 25.00 na na Fraxinus excelsior European ash 35/25 20/20/40 20%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $8,765.85 659 15.00 na na Fraxinus excelsior European ash 18/10 06/06/06 06%-Very Poor Photo Protected Moderate HR 1 (2x)24-in. $946.71 660 23.00 na na Fraxinus excelsior European ash 25/25 10/10/10 10%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $3,709.71 661 17.50 na na Fraxinus excelsior European ash 30/20 10/06/06 06%-Very Poor Photo Protected Moderate HR 1 (3x)24-in. $1,288.58 662 19.00 na na Fraxinus excelsior European ash 25/20 40/40/40 40%-Poor Photo Protected Moderate HR 1 (3x)24-in. $10,126.31 663 29.00 na na Fraxinus excelsior European ash 35/30 40/20/20 20%-Very Poor Photo Protected Moderate HR 1 (4X) 24-in. or (2x) 36-in.$11,795.33 664 15.00 13, 10.5 & 10.5 49.00 Fraxinus velutina Modesto ash 35/50 70/10/20 10%-Very Poor Large Protected Low Retain $2,032.06 665 12.50 na na Ligustrum lucidum Glossy privet 25/20 85/85/85 85%-Excellent Exempt Low Retain $5,490.09 666 27.00 na na Fraxinus excelsior European ash 25/30 30/30/30 30%-Poor Photo Protected High HR 1 (4X) 24-in. or (2x) 36-in.$15,336.73 667 35.00 na na Fraxinus velutina Modesto ash 35/30 50/10/20 10%-Very Poor Photo Protected Low HR 1 (4X) 24-in. or (2x) 36-in.$4,050.89 668 19.00 16.00 35.00 Magnolia grandiflora southern magnolia 25/20 70/50/70 50%-Fair Protected Low Retain $15,940.65 669 14.00 na na Washingtonia robusta Mexican fan palm 15/10 75/100/100 75%-Good Exempt Low Retain $1,012.50 670 4.50 na na Quercus agrifolia coast live oak 15/10 70/80/70 70%-Good Protected Low Retain $659.20 671 18.00 na na Quercus agrifolia coast live oak 35/30 70/50/50 50%-Fair Protected Low Retain $8,370.78 672 17.50 na na Pinus halepensis Aleppo pine 40/25 06/80/60 06%-Very Poor Photo Protected Low Remove 1, 3, 4, 10 (3x)24-in. $759.57 Large amount of damage on the southside of trunk, significant amount of large sized deadwood in the upper canopy. Numerous branch failures and large stem removals with subsequent hollows forming. Palm tree growing out of the center of the tree, indicative of soil and moisture buildup. Structure is very poor. Whole tree failure imminent- Recommend Removal. Codominant with included bark from ground level, up to 3ft. Typical for species, growing next to fence, appears to be a volunteer. Consider removal. Young tree appears to be a volunteer. Health is typical for species. Codominant union at 5ft., could benefit from structure pruning. codominant with included bark at approximately 5ft. Canopy grows predominantly Northeast due to the competition with surrounding trees. Tree no. 657-661 are all dying recommend removal. Tree no. 660 is 90% dead. Tree no. 657-661 are all dying recommend removal. Tree no. 661 is 50% dead. Tree no. 662 has extensive trunk decay and large size deadwood throughout the canopy. The tree grows predominantly to the north. Tree no. 663 has a significant amount of decay on the south side of the trunk, same as all other Ash trees in this immediate area. Large scaffold limbs have been removed to provide clearance, leaving significant wounding. Decay and a hollow at the base. Tree no. 664 is a multi trunk tree from ground level (appears to be a stump sprout). Structure is very poor, heavy lean to the West. Healthy, typical for species, likely a volunteer, growing at fenceline.Tree is under the size requirement for removal permit. Tree no. 657-661 are all dying-recommend removal. Tree no. 657 is 95% dead. Tree no. 657-661 are all dying recommend removal. Tree no. 658 is 50% dead. Tree no. 657-661 are all dying recommend removal. Tree no. 659 is 98% dead and exists as a stump with suckers. Tree is 85% dead. Severe discoloration in foliage and covered in pine galls. Recommend removal. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 382 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 673 9.00 na na Fraxinus uhdei Shamel ash 35/20 80/06/60 06%-Very Poor Photo Protected Low Remove 1, 3, 4, 10 (3x)24-in. $140.62 674 18.00 na na Quercus agrifolia coast live oak 35/20 70/60/60 60%-Fair Protected Low Retain $9,040.44 675 10.00 na na Olea europaea olive 15-Dec 40/40/20 20%-Very Poor Protected Low Retain $930.09 676 6.00 6.00 12.00 Ligustrum lucidum Glossy privet 25/15 50/50/30 30%-Poor Photo Exempt Low Remove 3, 4, 10, E (3x)24-in. $892.88 677 7.00 4.00 11.00 Fraxinus uhdei Shamel ash 25/15 50/20/10 10%-Very Poor Photo Protected Low Remove 1, 3, 4, 10 (3x)24-in. $161.21 678 22.00 na na Cupressus arizonica Arizona cypress 40/25 50/70/60 50%-Fair Photo Protected Low Remove 3, 4, 10 (3x)24-in. $19,092.02 679 26.00 na na Sequoia sempervirens coast redwood 40/25 70/20/20 20%-Very Poor Photo Protected Moderate Remove 1, 4, 10 (3x)24-in. $4,023.77 680 8.00 6.50 14.50 Ligustrum lucidum Glossy privet 35/10 10/06/06 06%-Very Poor Photo Exempt Low Remove 1, 4, 10, E (2x) 24-in. $263.52 681 26.00 na na Sequoia sempervirens coast redwood 50/20 80/90/80 80%-Good Photo Protected Low Remove 4, 10 (3x)24-in. $16,095.09 682 30.00 na na Sequoia sempervirens coast redwood 50/30 85/30/85 30%-Poor Photo Protected High Remove 4, 10 (4X) 24-in. or (2x) 36-in.$8,035.64 683 24.00 na na Sequoia sempervirens coast redwood 50/30 85/85/80 80%-Good Photo Protected Low Remove 4, 10 (4X) 24-in. or (2x) 36-in.$13,714.16 684 22.00 na na Sequoia sempervirens coast redwood 45/20 60/30/30 30%-Poor Photo Protected High Remove 1, 4, 10 (3x)24-in. $4,321.39 685 6.70 na na Sequoia sempervirens coast redwood 25/10 85/90/80 80%-Good Photo Protected Low Remove 4, 10 (2x) 24-in. $1,068.80 686 4.50 4 & 3 11.50 Fraxinus uhdei Shamel ash 20/10 70/20/20 20%-Very Poor Photo Protected Moderate HR 1 (2x) 24-in. $224.45 687 21.50 na na Cupressus arizonica Arizona cypress 35/10 40/40/30 30%-Poor Photo Protected Low HR 1 (2x) 24-in. $10,940.44 688 6.50 na na Quercus douglasii blue oak 25/15 80/40/50 40%-Poor Protected Low Retain $1,333.29 Fairly young tree, part of a grove. Half of the tree has been lost where it was once codominant. The remaining canopy appears good, but the structure is severely compromised. Recommend removal. Young tree typical for species. Currently being swamped by larger trees, causing it to develope an asymmetrical form. Triple trunk from ground level, volunteer that hangs over the main drive. Recommend removal due to structure and location. Tree leans heavily to the Northwest over the main drive, upper canopy has been damaged by adjacent redwood tree failure . Three large stems removed from base on south and east side, large wounds with decay forming. Recommend removal due to location and overall condition. Codominant and becoming included at approximately 15ft. This tree leans to the north over the main drive due to competition with other trees. It appears to be a volunteer, recommend pruning to improve structure. Large tree with sparse canopy that does not start until approximately 20ft., due to competition with ivy and privets. Understory has recently been cleaned out. Tree appears to have developed on a lean and then self corrected. May be actively leaning again (over the main drive). It has a codominant leader at approximately 20ft. with included bark and ivy has recently been removed from its base. Consider Hazardous-Recommend removal. Twin trunk tree from ground level with included bark. It grows directly into the redwood tree above. Tree is under the size requirement for removal permit-recommend removal. Tall, slender tree growing in part of a grove, all canopy foliage is to the north. Codominant structure with included bark at approximately 20ft. Although the structure is poor, the overall health and form appear to be good. Single trunk tree with canopy growth predominantly to the north. It is in competition with other adjacent trees. Volunteer specimen. Tree is young and growing amongst a privet hedge. Structure is codominant with included bark at approximately 15ft. Failure is likely to happen-consider removal. Codominant at approximately 30ft. Grows predominantly to the Northeast, searching for light out from amongst the privet hedge. Single trunk tree growing on a 90° angle out from under the canopy of a larger oak. The structure is codominant with included bark from ground level. The canopy grows predominantly to the South and east. Recommend removal. Stump sprout, codominant with included bark from ground level. Tree should be removed. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 383 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 689 12.00 na na Fraxinus uhdei Shamel ash 45/15 5/0/0 5%-Dying Photo Protected Low HR 1 (3x)24-in. $178.57 690 10.00 na na Fraxinus uhdei Shamel ash 45/15 80/60/60 60%-Fair Photo Protected Low HR 1 (3x)24-in. $1,488.08 691 17.00 na na Fraxinus uhdei Shamel ash 45/25 80/80/80 80%-Good Photo Protected Low HR 1 (3x)24-in. $5,734.07 692 5.50 na na Lagerstroemia sp.crape myrtle 20/20 90/85/90 85%-Excellent Protected Low Retain $2,415.68 693 5.50 na na Lagerstroemia sp.crape myrtle 20/20 90/85/90 85%-Excellent Protected Low Retain $2,415.68 694 6.00 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected Low Retain $2,705.75 695 6.80 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected Low Retain $3,475.38 696 6.80 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected Low Retain $3,475.38 697 6.70 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected Low Retain $3,373.92 698 6.60 na na Lagerstroemia sp.crape myrtle 20/20 90/20/10 10%-Very Poor Protected Low Retain $409.24 699 7.00 na na Lagerstroemia sp.crape myrtle 20/20 90/60/90 60%-Fair Protected Low Retain $2,762.12 700 6.30 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected Low Retain $2,983.09 701 5.40 na na Lagerstroemia sp.crape myrtle 20/10 90/80/90 80%-Good Protected Moderate Retain $2,191.66 702 5.20 na na Lagerstroemia sp.crape myrtle 20/10 90/80/90 80%-Good Protected Low Retain $2,032.32 703 5.20 na na Lagerstroemia sp.crape myrtle 20/10 90/80/90 80%-Good Protected Low Retain $2,032.32 704 3.40 2.7 & 2.4 8.50 Lagerstroemia sp.crape myrtle 20/10 80/30/80 30%-Poor Protected Low Retain $693.63 Tree is 95% dead, located at fencelinealong the main drive. Recommend removal. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 704 has large scaffold limbs that have been cut leaving "dog eared" stubs and associated decay, several sucker sprouts emerging. Structure is poor and would be difficult to improve with pruning. Longterm consider removal and replacement. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 698- lost the main leader. The structure and form is severely compromised. Longterm consider removal and replacement. Tree no. 699 has a large included union at approximately 5ft. In addition, there is a torn scaffold, limb from a branch that was close to the light. Recommend pruning to improve structure. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Growing at fenceline along the main drive. This is tall, slender form-appears to be a volunteer searching for light. Poor location with limited growing space. Recommend removal. Volunteer growing at fence line, poor location long-term, tree will be a problem-recommend removal. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Tree no. 692-704 are all planted in a line along the main driveway. Overall, good health, structure and form-typical for species. Some could benefit from structure pruning. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 384 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 705 5.50 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected None Retain Out of Work Area 706 1.00 1,1,1,1,1,1, 1 & 1 9.00 Lagerstroemia sp.crape myrtle 15/10 90/10/50 10%-Very Poor Protected None Retain Out of Work Area 707 1.50 1.5,1.5,1.5, 1.5, 1.5, 1.5, 1.5 & 1 13.00 Lagerstroemia sp.crape myrtle 20/20 90/10/50 10%-Very Poor Protected None Retain Out of Work Area 708 2.00 2, 1.5, 1.5, 1.5, & 1 9.50 Lagerstroemia sp.crape myrtle 20/15 90/10/50 10%-Very Poor Protected None Retain Out of Work Area 709 2.00 2, 1.5, 1.5, 1.5, 1.5, 1, 1, & 1 13.00 Lagerstroemia sp.crape myrtle 20/20 90/10/50 10%-Very Poor Protected None Retain Out of Work Area 710 4.00 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected None Retain Out of Work Area 711 8.00 na na Lagerstroemia sp.crape myrtle 25/25 90/80/90 80%-Good Protected None Retain Out of Work Area 712 6.80 na na Platanus acerifolia 'Columbia' London plane tree 25/20 80/80/80 80%-Good Protected None Retain Out of Work Area 713 4.50 na na Platanus acerifolia 'Columbia' London plane tree 20/10 80/80/80 80%-Good Protected None Retain Out of Work Area 714 8.50 8.50 17.00 Quercus agrifolia coast live oak 20/25 70/70/70 70%-Good Protected None Retain Out of Work Area 715 7.50 na na Sequoia sempervirens coast redwood 22/10 90/95/95 90%-Excellent Protected None Retain Out of Work Area 716 10.00 na na Sequoia sempervirens coast redwood 28/10 95/95/95 95%-Excellent Protected None Retain Out of Work Area 717 7.30 na na Platanus acerifolia 'Columbia' London plane tree 25/15 80/80/80 80%-Good Protected None Retain Out of Work Area 718 15.00 na na Platanus acerifolia 'Columbia' London plane tree 45/30 80/80/80 80%-Good Protected None Retain Out of Work Area 719 12.40 na na Platanus acerifolia 'Columbia' London plane tree 35/30 80/80/80 80%-Good Protected None Retain Out of Work Area 720 9.30 na na Platanus acerifolia 'Columbia' London plane tree 30/20 80/80/80 80%-Good Protected None Retain Out of Work Area Trees no. 705-711 are located in the main parking area, close to the ball netting, dividing the parking lot from the course. Trees no. 705-711 are located in the main parking area, close to the ball netting, dividing the parking lot from the course. Trees no. 706-709 multi trunk specimens. Trees no. 705-711 are located in the main parking area, close to the ball netting, dividing the parking lot from the course. Trees no. 706-709 multi trunk specimens. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Small stature, grows on slope and has been pruned up to ~7ft. for clearance, root area heavily exposed. Good health, structure and form. Tree no. 715 and 716 both young coast redwoods, located on slope between cart path, retaining wall and main parking lot. This is the smaller of the two trees, they are both planted too close together for mature size. Longterm consider removing one. Tree no. 715 and 716 are two young coast redwood trees, located on slope between cart path, retaining wall and main parking lot. Both of these trees are planted within 4-5ft. from the retaining wall and iron fence. Overall near perfect health, structure and form-typical for young species. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Trees no. 705-711 are located in the main parking area, close to the ball netting, dividing the parking lot from the course. Trees no. 706-709 multi trunk specimens. Trees no. 705-711 are located in the main parking area, close to the ball netting, dividing the parking lot from the course. Trees no. 706-709 multi trunk specimens. Trees no. 705-711 are located in the main parking area, close to the ball net, dividing the parking lot from the course. Trees no. 705-711 are located in the main parking area, close to the ball net, dividing the parking lot from the course. Tree no. 712-713 and 717-736 are all young Sycamore trees growing throughout the parking lot. All trees appear to be well-maintained and pruned for clearance over parking spaces and lights. Overall good condition, structure and form. Tree no. 712-713 and 717-736 are all young Sycamore trees growing throughout the parking lot. All trees appear to be well-maintained and pruned for clearance over parking spaces and lights. Overall good condition, structure and form. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 385 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 721 8.70 na na Platanus acerifolia 'Columbia' London plane tree 30/20 80/80/80 80%-Good Protected None Retain Out of Work Area 722 8.70 na na Platanus acerifolia 'Columbia' London plane tree 30/20 80/80/80 80%-Good Protected None Retain Out of Work Area 723 7.50 na na Platanus acerifolia 'Columbia' London plane tree 30/10 80/80/80 80%-Good Protected None Retain Out of Work Area 724 11.00 na na Platanus acerifolia 'Columbia' London plane tree 35/20 80/80/80 80%-Good Protected None Retain Out of Work Area 725 9.00 na na Platanus acerifolia 'Columbia' London plane tree 30/20 80/80/80 80%-Good Protected None Retain Out of Work Area 726 8.50 na na Platanus acerifolia 'Columbia' London plane tree 30/20 80/80/80 80%-Good Protected None Retain Out of Work Area 727 7.00 na na Platanus acerifolia 'Columbia' London plane tree 25/10 80/80/80 80%-Good Protected None Retain Out of Work Area 728 6.00 na na Platanus acerifolia 'Columbia' London plane tree 18/10 80/80/80 80%-Good Protected None Retain Out of Work Area 729 7.50 na na Platanus acerifolia 'Columbia' London plane tree 20/10 80/80/80 80%-Good Protected None Retain Out of Work Area 730 6.50 na na Platanus acerifolia 'Columbia' London plane tree 20/10 80/80/80 80%-Good Protected None Retain Out of Work Area 731 6.00 na na Platanus acerifolia 'Columbia' London plane tree 20/10 80/80/80 80%-Good Protected None Retain Out of Work Area 732 6.30 na na Platanus acerifolia 'Columbia' London plane tree 20/10 80/80/80 80%-Good Protected None Retain Out of Work Area 733 9.00 na na Platanus acerifolia 'Columbia' London plane tree 30/15 80/80/80 80%-Good Protected None Retain Out of Work Area 734 8.50 na na Platanus acerifolia 'Columbia' London plane tree 25/15 80/80/80 80%-Good Protected None Retain Out of Work Area 735 8.00 na na Platanus acerifolia 'Columbia' London plane tree 30/15 80/80/80 80%-Good Protected None Retain Out of Work Area 736 8.00 na na Platanus acerifolia 'Columbia' London plane tree 25/15 80/80/80 80%-Good Protected None Retain Out of Work Area Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Relatively young tree growing in the main parking lot. Overall good health, structure and form. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 386 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 737 6.00 4, 3, & 2 15.00 Olea europaea olive 15-Dec 85/80/80 80%-Good Protected None Retain Out of Work Area 738 14.00 na na Pyrus kawakami evergreen pear 30/30 10/10/10 10%-Very Poor Protected None Retain Out of Work Area 739 15.00 13, 12 & 12 52.00 Eucalyptus camaldulensis red gum 55/40 85/20/40 20%-Very Poor Photo Large Protected None HR 1 (4X) 24-in. or (2x) 36-in.Out of Work Area 740 7.70 na na Quercus ilex holly oak 15/12 85/80/80 80%-Good Protected None Retain Out of Work Area 741 5.50 na na Magnolia grandiflora southern magnolia 20/10 30/30/65 30%-Poor Protected Low Retain $328.24 742 6.50 na na Magnolia grandiflora southern magnolia 30/15 80/60/85 60%-Fair Protected None Retain Out of Work Area 743 3.80 na na Magnolia grandiflora southern magnolia 20/15 30/70/90 30%-Poor Protected None Retain Out of Work Area 744 7.00 na na Lagerstroemia sp.crape myrtle 20/15 90/80/90 80%-Good Protected None Retain Out of Work Area 745 6.50 na na Lagerstroemia sp.crape myrtle 20/15 90/70/90 70%-Good Protected None Retain Out of Work Area 746 6.30 na na Lagerstroemia sp.crape myrtle 20/20 90/80/90 80%-Good Protected None Retain Out of Work Area 747 7.80 na na Lagerstroemia sp.crape myrtle 20/30 90/70/90 70%-Good Protected None Retain Out of Work Area 748 16.00 na na Butia capitata Pindo palm 8/10 60/95/95 60%-Fair Exempt None Retain Out of Work Area 749 20.00 na na Butia capitata Pindo palm 10/15 95/95/95 95%-Excellent Exempt None Retain Out of Work Area 750 9.00 na na Syagrus romanzoffiana Queen palm 15/02 60/90/90 60%-Fair Exempt None Retain Out of Work Area 751 10.50 na na Syagrus romanzoffiana Queen palm 15/02 60/90/90 60%-Fair Exempt None Retain Out of Work Area 752 10.20 na na Syagrus romanzoffiana Queen palm 15/02 60/90/90 60%-Fair Exempt None Retain Out of Work Area Tree is located next to the cart wash station and underground electrical box. Poor condition. Longterm consider removal and replacement. Growing next to the cart wash station and electrical junction box. Large tree, possibly a stump sprout that has regrown or a volunteer with multiple trunks from ground level. Large inclusions between main unions. Tree leans over the clubhouse and the powerlines. Consider hazardous -Recommend Removal. Growing in a poor location, appears to have been removed and re-sprouted. Overall healthy and vigorous growth, recommend maintaining or removing completely. Tree no. 741-743 are all small, Southern magnolia trees growing next to fitness center/parking lot ball netting. Could benefit from additional water and 2- 3in. of mulch over the root zone. Tree no. 741-minor deadwood throughout, poor codominant union and included bark at 7ft., tree appears stressed. Tree no. 741-743 are all small, Southern magnolia trees growing next to fitness center/parking lot ball netting. Could benefit from additional water and 2- 3in. of mulch over the root zone. Tree no. 742 is growing right next to the net pole. Overall good condition - could benefit from structure pruning. Tree no. 741-743 are all small, Southern magnolia trees growing next to fitness center/parking lot ball netting. Could benefit from additional water and 2- 3in. of mulch over the root zone. Tree no. 743 is a young tree and appears somewhat stressed. There is a large amount of small deadwood in canopy. Young tree, heavily pruned for camera clearance. Tree no. 750-757 are all queen palms located inside the pool area. All trees appear to be growing within in a limited growing space and have slightly chlorotic foliage. Tree no. 750-757 are all queen palms located inside the pool area. All trees appear to be growing within in a limited growing space and have slightly chlorotic foliage. Tree no. 750-757 are all queen palms located inside the pool area. All trees appear to be growing within in a limited growing space and have slightly chlorotic foliage. Tree no. 744-747 are all single trunk trees of the same species, growing adjacent to the pool fence on the parking lot side. Tree no. 744 has been planted under the net, between the pool fence and the parking lot. There is a large flush cut over the parking lot side at the main union. Tree no. 744-747 are all single trunk trees of the same species, growing adjacent to the pool fence on the parking lot side. Tree no. 745 has a poor main union where all branches originate from. This would have been best to correct when the tree was younger. Tree no. 744-747 are all single trunk trees of the same species, growing adjacent to the pool fence on the parking lot side. Tree no. 744-747 are all single trunk trees of the same species, growing adjacent to the pool fence on the parking lot side. Tree no. 747 has a poor union and would benefit from structural pruning. Tree no. 748 is a palm tree located to the right of main pool gate. The foliage appears slightly mottled. Tree no. 749 is located to the left main pool gate. Overall health appears good and typical for species. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 387 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 753 9.00 na na Syagrus romanzoffiana Queen palm 15/02 60/90/90 60%-Fair Exempt None Retain Out of Work Area 754 10.50 na na Syagrus romanzoffiana Queen palm 15/02 60/90/90 60%-Fair Exempt None Retain Out of Work Area 755 10.50 na na Syagrus romanzoffiana Queen palm 15/02 60/90/90 60%-Fair Exempt None Retain Out of Work Area 756 10.50 12.50 23.00 Syagrus romanzoffiana Queen palm 15/02 90/60/90 60%-Fair Exempt None Retain Out of Work Area 757 10.00 9.50 19.50 Syagrus romanzoffiana Queen palm 15/02 90/60/90 60%-Fair Exempt None Retain Out of Work Area 758 11.40 na na Sequoia sempervirens coast redwood 25/10 50/90/90 50%-Fair Protected L Retain $1,289.27 759 9.70 na na Sequoia sempervirens coast redwood 15/10 60/10/10 10%-Very Poor Protected L Retain $186.68 760 10.40 na na Sequoia sempervirens coast redwood 25/10 60/90/80 60%-Fair Protected None Retain Out of Work Area 761 5.60 na na Acacia dealbata silver wattle 25/10 85/40/50 40%-Poor Protected None Retain Out of Work Area 762 23.70 19.10 42.80 Quercus agrifolia coast live oak 35/35 25/20/25 20%-Very Poor Large Protected None Retain Out of Work Area 763 20.00 na na Eucalyptus camaldulensis red gum 50/30 80/80/80 80%-Good Exempt None Retain Out of Work Area 764 43.20 na na Quercus agrifolia coast live oak 35/40 85/40/85 40%-Poor Large Protected None Retain Out of Work Area 765 17.00 12.00 29.00 Eucalyptus camaldulensis red gum 50/40 70/06/06 06%-Very Poor Protected None Retain Out of Work Area 766 14.50 na na Acacia dealbata silver wattle 30/20 50/50/50 50%-Fair Protected None Retain Out of Work Area 767 5.50 na na Cupressus arizonica Arizona cypress 15/12 60/80/90 60%-Fair Protected None Retain Out of Work Area 768 4.80 na na Cupressus arizonica Arizona cypress 15/12 80/80/90 80%-Good Protected None Retain Out of Work Area Tree no. 756 & 757 are twin trunk specimen from grade-likely planted that way for aesthetic purposes Tree no. 756 & 757 are twin trunk specimen from grade-likely planted that way for aesthetic purposes Located close to the driving range along Wedgewood Ave. at fenceline. Sparse canopy with some tip back. Lost its main central leader and is regrowing. Rootzone area is limited, grows between fence, cart path, and new sidewalk along Wedgewood Ave. Could prove to have inadequate space for such a large tree at maturity. Irrigation for understory plants appears to have been recently repaired or newly installed. Tree appears to be mildly impacted by recent root zone disturbance. Volunteer species growing next to cart path. Visible trunk damage. Tree no. 750-757 are all queen palms located inside the pool area. All trees appear to be growing within in a limited growing space and have slightly chlorotic foliage. Tree no. 750-757 are all queen palms located inside the pool area. All trees appear to be growing within in a limited growing space and have slightly chlorotic foliage. Tree no. 750-757 are all queen palms located inside the pool area. All trees appear to be growing within in a limited growing space and have slightly chlorotic foliage. Trees no. 767-768 are both young trees with slightly chlorotic foliage. Soil is built up at base. This tree would benefit from structure pruning. Tree has a large amount of decay at the base. Trunk appears to have inspect/pest damage. Tree is actively cracking at the codominant union on the East side. Foliage is affected by, possibly, Cryptocline cinerescens (oak twig blight)-canopy dieback from lower branches upward. Poor overall condition. Nice tree-typical for species. Tree is under the size requirement for removal permit. Multi trunk tree with included bark between the unions. Some bark damage from borers on trunk. Tree appears healthy. Recommend removal of Eucalyptus branch (from tree #765) that is impeding upper canopy. Large tree, codominant from base. Recommend removal of smaller stem growing into and resting on tree no. 764. Central leader snapped off at approximately 40ft., minor deadwood. Longterm consider removal to allow room for volunteer oaks. Tree has the broken tree no. 765, resting in its canopy. Foliage is chlorotic. Poor structure and form, limited growing space, in heavy competition with adjacent trees. Trees no. 767-768 are both young trees with slightly chlorotic foliage. Soil is built up at base. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 388 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 769 5.70 3.50 9.20 Quercus agrifolia coast live oak 15/15 80/60/70 60%-Fair Protected None Retain Out of Work Area 770 7.00 na na Quercus agrifolia coast live oak 15/10 80/60/70 60%-Fair Protected None Retain Out of Work Area 771 9.00 7.5, 6, 5, 5, 5, 4.5, 4, 4, & 3.3 53.30 Acacia dealbata silver wattle 25/40 70/10/15 10%-Very Poor Protected None Retain Out of Work Area 772 16.00 na na Sequoia sempervirens coast redwood 30/20 65/90/90 65%-Good Protected None Retain Out of Work Area 773 32.00 na na Acacia dealbata silver wattle 30/45 20/75/85 20%-Very Poor Protected None Retain Out of Work Area 774 8.00 na na Sequoia sempervirens coast redwood 20/10 06/06/06 06%-Very Poor Protected None Retain Out of Work Area 775 18.00 na na Sequoia sempervirens coast redwood 40/20 65/90/90 65%-Good Protected None Retain Out of Work Area 776 7.20 na na Acacia dealbata silver wattle 25/15 80/80/80 80%-Good Protected None Retain Out of Work Area 777 9.00 na na Quercus agrifolia coast live oak 20/10 75/25/70 25%-Poor Protected None Retain Out of Work Area 778 4.30 2.50 6.80 Quercus agrifolia coast live oak 15/15 70/70/80 70%-Good Protected None Retain Out of Work Area 779 11.00 na na Sequoia sempervirens coast redwood 35/15 65/90/80 65%-Good Protected None Retain Out of Work Area 780 5.70 4.30 10.00 Acacia baileyana Cootamundra wattle 25/20 75/60/65 60%-Fair Protected None Retain Out of Work Area 781 12.00 na na Pinus halepensis Aleppo pine 35/10 70/60/60 60%-Fair Protected None Retain Out of Work Area 782 15.70 na na Pinus halepensis Aleppo pine 40/15 80/85/85 80%-Good Protected None Retain Out of Work Area 783 21.00 na na Pinus halepensis Aleppo pine 50/25 80/85/85 80%-Good Protected None Retain Out of Work Area 784 8.50 na na Pinus halepensis Aleppo pine 25/8 20/20/20 20%-Very Poor Protected None Retain Out of Work Area Tree is buried at the base with excess soil, root zone appears to be compromised, tree appears to be dying- foliage is chlorotic with tip dieback throughout. Chlorotic foliage, grows at edge of a gravel path, root zone is compacted. Young, volunteer specimen surrounded by seedlings at base or possibly shoots coming off the roots. Young volunteer specimen with codominant structure and included bark at 5ft. This structural defect could be corrected with pruning. The root zone has recently been impacted with excess soil on the southside. Recommend pruning and removal of soil. Young tree with small, slightly stunted foliage. This change in growth could be related to the excess soil buildup around the root zone. This tree could benefit from structure pruning and soil removal. Chlorotic foliage with some minor tipped dieback. There has been a recent change in soil grade, recommend removal of excess soil from around the root zone. Trees no. 769-770 are young trees planted on the edge of the driving range, adjacent to a well used gravel path. Both trees have poor structure. Tree no. 769 has small cracks in trunk and bleeding on trunk. This tree should have irrigation tubing removed from base of trunk. Trees no. 769-770 are young trees planted on the edge of the driving range, adjacent to a well used gravel path. Both trees have poor structure. Tree no. 769 has small cracks in trunk and bleeding on trunk. Consists of trunk and stump sprouts, very poor overall structure. Volunteer growing at fenceline. Consider removal. Tree has chlorotic foliage. Mature specimen that appears to be in the stage of senescence. Large amount of deadwood, no trunk flare at base, and appears to have soil buildup (soil recently added to the area). This tree is located along the fenceline, adjacent to Wedgewood Ave. Form is asymmetrical due to competition with adjacent pine trees. Also a changing in grade with soil built up in the root zone, recommend removal of excess soil. Young tree that has experienced change in soil grade, recommend excess soil removal from the root zone before it impacts the tree Tree no .782-783 Grow towards the southwest. Soil grade has recently changed within the last year. Tree no. 782 is a single trunk tree, growing within a grove. Overall condition appears typical for healthy species. Tree no .782-783 Grow towards the southwest. Soil grade has recently changed within the last year. Tree no. 782 is a single trunk tree, growing within a grove. Overall condition appears typical for healthy species. Tree no. 784 Grows with 782 & 783 but is shorter than the previous two Pines. Overall structure is poor. The tree is being out competed by adjacent trees. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 389 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 785 20.00 na na Pinus halepensis Aleppo pine 35/20 80/40/40 40%-Poor Protected None Retain Out of Work Area 786 11.40 na na Pinus halepensis Aleppo pine 35/20 90/90/90 90%-Excellent Protected None Retain Out of Work Area 787 17.00 na na Pinus halepensis Aleppo pine 40/25 75/90/85 75%-Good Protected None Retain Out of Work Area 788 19.00 na na Quercus agrifolia coast live oak 30/30 40/85/65 40%-Poor Protected None Retain Out of Work Area 789 17.50 na na Pinus halepensis Aleppo pine 45/20 90/90/70 70%-Good Protected None Retain Out of Work Area 790 19.20 14.00 33.20 Quercus agrifolia coast live oak 30/30 80/70/70 70%-Good Large Protected None Retain Out of Work Area 791 6.00 5.2 & 4.5 15.70 Acacia dealbata silver wattle 25/20 80/40/50 40%-Poor Protected None Retain Out of Work Area 792 7.50 6.50 14.00 Acacia dealbata silver wattle 28/20 80/06/50 06%-Very Poor Protected None Retain Out of Work Area 793 9.00 na na Pinus halepensis Aleppo pine 30/10 60/60/50 50%-Fair Protected None Retain Out of Work Area 794 5.00 4, 3, 3 & 2 17.00 Acacia dealbata silver wattle 25/20 80/20/40 20%-Very Poor Protected None Retain Out of Work Area 795 21.00 na na Pinus halepensis Aleppo pine 45/15 80/85/70 70%-Good Protected None Retain Out of Work Area 796 16.00 na na Pinus halepensis Aleppo pine 40/15 80/85/80 80%-Good Protected None Retain Out of Work Area 797 14.00 12.00 26.00 Pinus halepensis Aleppo pine 25/15 65/40/50 40%-Poor Protected None Retain Out of Work Area 798 16.80 na na Pinus halepensis Aleppo pine 35/15 60/80/50 50%-Fair Protected None Retain Out of Work Area 799 6.70 4.70 11.40 Acacia dealbata silver wattle 20/20 70/30/45 30%-Poor Protected None Retain Out of Work Area 800 10.30 na na Pinus halepensis Aleppo pine 22/15 30/40/30 30%-Poor Protected None Retain Out of Work Area Codominant structure with a very poor union. Failure is likely to occur unless the tree is pruned to remove one of the trunks. Young tree- typical for species. Codominant trunk at 12ft., form is very asymmetrical. Appears there was possibly another tree behind it that failed. Majority of the foliage growth is to the south-Could benefit from structure pruning. Tree appears to be a volunteer cluster of small trunks. Good health and form, poor structure. It is growing at the base of adjacent pine no. 795. Single trunk tree growing on a lean to the south, towards the sun. Overall good health for a young tree, typical for species Young tree, grows with a bow in the trunk, to the north-appears to have self corrected. There is a slight amount of soil buildup around the root zone. Codominant from 4ft. with poor union. This is one of several trees in a grove. There has been a recent change in soil grade within the root zone. Minor browning of needles noted throughout the canopy. Young tree located between the fence and no. 785. This tree has a single trunk, straight tree-good specimen overall. Single trunk tree that has minor dead wood, good form and structure. Some chlorotic, stunted foliage noted. Could be related to recent change on south side. Appears to be suffering from Cryptocline cinerescens (oak twig blight) with the lower foliage being affected. The canopy is sparse overall, the form is impacted by the neighboring trees, and the recent soil buildup at the base may be affecting condition. Tree is competing with the adjacent oak tree. There has been a recent soil grade change around the base. Tree appears to be healthy and unaffected at this time- recommend removal of excess soil. Nice looking tree that grows against the fencelineat Wedgewood Ave. The structure is good, but the form is being affected by clearance pruning on the southwest side, over the road. No visible trunk flare. Twin trunk tree, with codominant at ground level. It was likely planted for screening or came up as a volunteer. Recent soil grade change around the base. Tree becomes codominant at approximately 10ft. with a good union. Grows out from larger tree at the edge of the stand. 100% of the canopy grows to the South. Top of the main stem has failed. Young tree located next to the fence. Minor deadwood in the lower canopy. Recent change in soil grade, may have negative affect, longterm. Recommend removal of soil. Volunteer specimen with poor form, growns on a lean to the south. Multiple trunks and recent soil buildup around the root zone. Tree grows up beneath the canopy of a larger, older coast live oak. Structure, form, and health are compromised by competition. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 390 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 801 25.50 14.80 40.30 Quercus agrifolia coast live oak 30/40 70/06/50 06%-Very Poor Large Protected None Retain Out of Work Area 802 13.50 na na Pinus halepensis Aleppo pine 35/30 80/60/65 60%-Fair Protected None Retain Out of Work Area 803 17.00 12.6, 12 & 7.7 49.30 Quercus agrifolia coast live oak 35/45 85/20/50 20%-Very Poor Large Protected None Retain Out of Work Area 804 7.80 na na Quercus agrifolia coast live oak 25/10 85/60/70 60%-Fair Protected None Retain Out of Work Area 805 9.80 14.00 23.80 Quercus lobata valley oak 25/20 85/20/80 20%-Very Poor Protected None Retain Out of Work Area 806 4.30 na na Quercus agrifolia coast live oak 10/10 50/75/50 50%-Fair Protected None Retain Out of Work Area 807 12.00 10.50 22.50 Quercus agrifolia coast live oak 28/25 85/45/65 45%-Fair Protected None Retain Out of Work Area 808 4.30 3.50 7.80 Quercus agrifolia coast live oak 10/8 85/40/40 40%-Poor Protected None Retain Out of Work Area 809 16.50 na na Quercus agrifolia coast live oak 30/20 60/20/50 20%-Very Poor Protected None Retain Out of Work Area 810 10.20 na na Quercus agrifolia coast live oak 30/10 60/25/50 25%-Poor Protected None Retain Out of Work Area 811 3.40 1.80 5.20 Quercus agrifolia coast live oak 15/10 80/80/80 80%-Good Protected None Retain Out of Work Area 812 12.00 na na Quercus agrifolia coast live oak 30/20 80/20/50 20%-Very Poor Protected None Retain Out of Work Area 813 7.70 4 & 4 15.70 Quercus ilex holly oak 25/20 80/20/40 20%-Very Poor Protected None Retain Out of Work Area 814 7.50 5.3 & 3.5 16.30 Quercus ilex holly oak 30/15 80/50/60 50%-Fair Protected None Retain Out of Work Area 815 5.00 na na Acacia dealbata silver wattle 30/15 90/85/85 85%-Excellent Protected None Retain Out of Work Area 816 7.70 na na Acacia dealbata silver wattle 25/08 90/65/75 65%-Good Protected None Retain Out of Work Area Growing at fence line, codominant structure with included bark at 7ft. Canopy appears healthy and provides a good screen. Young volunteer growing at fenceline.Structure is codominant at 2ft., fair union. Tree would benefit from structure pruning. Eventually, the fence will become embedded in the bark. Grows along the creek fenceline. Codominant structure with included union at approximately 10ft. Grows along the fenceline, fence embedded at ground level. Structure is codominant from zero to 2ft., form is asymmetrical. Tree has been topped and regrown with multiple stems at 10ft. Multiple leaders from 2ft. Very codominant structure, grows along fenceline and is competing for space with adjacent oak. Could benefit from structure pruning. Tree no. 815–820 are all volunteers growing along the fenceline. Young tree, most likely a volunteer. Grows adjacent to the fence and power pole. The trunk is codominant at 15ft. Limited growing space for a tree of this size. It will require regular maintenance around the power line, if it is to remain. Growing at fence line, most likely a volunteer. Fence embedded at the base of the trunk. Structure is codominant with included bark. Young tree that appears to have stunted foliage. It could be root related from the nursery or soil compaction, around its root zone. Most likely a volunteer and grows in the southeast corner of the driving range, against chain-link fence. Structure is codominant with included bark from ground level. Tree could benefit from structure, pruning. Young tree growing at fence line, most likely a volunteer. The structure is codominant with poor union and limited in its growth due to its location. Chain- link fence will end up embedded in the trunk long-term. Growing along the chain-link fence that separates the course from the creek. Structure is codominant with included bark at 5ft. Chain-link fence is embedded in the union from ground to 6ft. Low, sprawling oak tree, actively splitting apart. Lost central leader in the past. Recommend removal of the codominant trunk that is included from ground level and again at 6–8ft., poor overall structure. Young tree surrounded by other young volunteer oaks, which should be encouraged grow as they make a nice vegetative screen. This tree in particular is codominant at approximately 5ft. with a good union. Large sprawling tree with multiple leaders. Three main unions branch out at 2.5ft. Borer damage to the bark and no trunk flare. The canopy competes for space with the street tree. Funal fruiting bodies and borer activity noted in the main union. The tallest main leader is codominant with included bark and swelling at approximately 10ft. This tree will split eventually if not tended to. Tree no. 815–820 are all volunteers growing along the fenceline. Tree no. 816 is codominant at 5ft. with fair union. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 391 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 817 4.30 na na Acacia dealbata silver wattle 30/08 90/60/50 50%-Fair Protected None Retain Out of Work Area 818 5.00 na na Acacia dealbata silver wattle 30/08 90/90/90 90%-Excellent Protected None Retain Out of Work Area 819 4.00 na na Acacia dealbata silver wattle 30/10 90/30/10 10%-Very Poor Protected None Retain Out of Work Area 820 6.80 na na Acacia dealbata silver wattle 30/10 85/85/85 85%-Excellent Protected None Retain Out of Work Area 821 3.20 3.2 & 2.3 8.70 Pistachio chinensis Chinese pistache 25/15 80/30/40 30%-Poor Protected None Retain Out of Work Area 822 10.00 na na Acacia dealbata silver wattle 30/20 85/75/70 70%-Good Protected None Retain Out of Work Area 823 10.00 na na Acacia dealbata silver wattle 30/20 85/75/75 75%-Good Protected None Retain Out of Work Area 824 4.50 4.20 8.70 Cupressus arizonica Arizona cypress 25/15 85/20/30 20%-Very Poor Protected None Retain Out of Work Area 825 4.00 na na Cupressus arizonica Arizona cypress 20/10 85/85/85 85%-Excellent Protected None Retain Out of Work Area 826 10.00 8, 6 & 5 29.00 Quercus ilex holly oak 35/30 60/30/70 30%-Poor Large Protected None Retain Out of Work Area 827 4.00 na na Quercus agrifolia coast live oak 5-Oct 80/45/45 45%-Fair Protected None Retain Out of Work Area 828 4.00 3 & 2.8 9.80 Quercus agrifolia coast live oak 18/15 85/20/80 20%-Very Poor Protected None Retain Out of Work Area 829 7.00 na na Sequoia sempervirens coast redwood 22/08 70/90/85 70%-Good Protected None Retain Out of Work Area 830 6.70 na na Cupressus arizonica Arizona cypress 22/12 90/90/90 90%-Excellent Protected None Retain Out of Work Area 831 8.00 na na Cupressus arizonica Arizona cypress 24/10 70/80/70 70%-Good Protected None Retain Out of Work Area 832 15.50 15,15,10, 9.5,9,8,7,6, 6,5, & 4 110.00 Quercus agrifolia coast live oak 35/60 80/40/80 40%-Poor Large Protected None Retain Out of Work Area Young volunteer that grows at fenceline. Tree has good form and poor structure. Structure is codominant and included from ground level, then again at 4ft. Young, single trunk tree, that appears slightly thin in the canopy. Appears ot have minor mechanical damage to roots and lower canopy. Young, healthy tree typical for species. Young healthy tree typical for species. Canopy is slightly thin and grows on a lean due to competition with larger oak. Recommend clearance pruning larger oak. Large, sprawling tree growing into the fence. Rat nest at the base, multi trunk unions at ground level and fence embedded in numerous places with grafting between some of the unions. Tree no. 822-823 are all young trees. Structure is codominant at 5ft. with a good union. Both trees would benefit from structure pruning. Tree no. 822-823 are all young trees. Structure is codominant at 5ft. with a good union. Both trees would benefit from structure pruning. Tree no .824 is a young tree, codominant from ground level and evidence of a third trunk that failed in the past. Form is now asymmetrical. Tree should be pruned to eliminate future failure. Tree no .825 is a young healthy tree -Typical for species. Tree no. 826 is growing along the fenceline, has multiple trunks from ground level and a large rat nest between the trunks at the base. The chain-link fence is embedded in the trunk, foliage appears thin. Tree no. 827 is a small tree with recent root disturbance from excavation work to open trench for water pipeline repair. Tree no. 815–820 are all volunteers growing along the fenceline. Tree no. 817 has a codominant structure at 7ft. with a fair union. Tree would benefit from structure pruning. Tree no. 815–820 are all volunteers growing along the fenceline. Tree no .818 is a young, tall, and spindly in form. Tree no. 815–820 are all volunteers growing along the fenceline. Top of the tree has been lost and regrown at about 10ft., developing multiple leaders. Tree no. 815–820 are all volunteers growing along the fenceline. Tree no. 820 is a young tree typical for species. Tree no 821 is a young volunteer growing up at fenceline.Structure is codominant at 4ft., would benefit from structure pruning. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 392 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 833 7.70 na na Sequoia sempervirens coast redwood 25/15 90/90/90 90%-Excellent Protected None Retain Out of Work Area 834 21.50 na na Sequoia sempervirens coast redwood 35/25 90/90/90 90%-Excellent Protected None Retain Out of Work Area 835 21.50 na na Sequoia sempervirens coast redwood 35/25 90/90/90 90%-Excellent Protected None Retain Out of Work Area 836 24.50 na na Sequoia sempervirens coast redwood 35/30 90/90/90 90%-Excellent Protected None Retain Out of Work Area 837 5.50 na na Quercus agrifolia coast live oak 18/10 30/80/80 30%-Poor Protected None Retain Out of Work Area 838 9.00 na na Eucalyptus camaldulensis red gum 28/20 80/40/20 20%-Very Poor Exempt None Retain Out of Work Area 839 10.00 7.70 17.70 Quercus ilex holly oak 28/15 60/30/30 30%-Poor Protected None Retain Out of Work Area 840 30.00 na na Quercus agrifolia coast live oak 35/30 80/20/60 20%-Very Poor Large Protected None Retain Out of Work Area 841 4.40 na na Sequoia sempervirens coast redwood 15/10 70/90/90 70%-Good Protected None Retain Out of Work Area 842 24.00 18.00 42.00 Eucalyptus camaldulensis red gum 60/30 85/60/80 60%-Fair Protected None Retain Out of Work Area 843 13.50 na na Eucalyptus camaldulensis red gum 50/20 85/85/85 85%-Excellent Exempt None Retain Out of Work Area 844 14.00 8.00 22.00 Quercus agrifolia coast live oak 30/30 80/60/70 60%-Fair Protected None Retain Out of Work Area 845 19.00 na na Eucalyptus camaldulensis red gum 70/40 70/50/50 50%-Fair Exempt None Retain Out of Work Area 846 11.50 na na Eucalyptus camaldulensis red gum 50/25 50/50/30 30%-Poor Exempt None Retain Out of Work Area 847 7.50 na na Eucalyptus camaldulensis red gum 30/15 50/20/20 20%-Very Poor Exempt None Retain Out of Work Area 848 9.00 na na Eucalyptus camaldulensis red gum 30/15 30/20/20 20%-Very Poor Exempt None Retain Out of Work Area Tree no. 833-836 are all young, healthy trees, typical of species. Growing at fenceline and stunted beneath the larger eucalyptus tree. Tree is under the size requirement for removal permit. Young tree in a grove of volunteers. Leans out away from larger canopy trees. Tree is under the size requirement for removal permit. Young volunteer tree, codominant at 7ft. and has a heavy lean. Tree is under the size requirement for removal permit. Trifurcated at 7ft., with fence embedded in the trunk. Very poor structure. Young tree growing next to compacted, gravel dirt path. Canopy is think and relatively open, with minor, broken branches. Tree is growing at fence line, structure is compromised by codominant leaders from ground level and included bark. Young, healthy, single trunk tree-typical for species. Tree is under the size requirement for removal permit. Growing at fenceline, under larger eucalyptus canopies. Small included branch at 4.5ft.-would benefit from structure pruning. Growing at fenceline, at the edge of a grove, largely asymmetrical. Tree is under the size requirement for removal permit. Tree no. 833-836 are all young, healthy trees, typical of species. Tree no. 834 has a small mechanical wound at the base on the east side Tree no. 833-836 are all young, healthy trees, typical of species. Tree no. 833-836 are all young, healthy trees, typical of species. Young tree with extreme chlorosis on the southwest side, overall good form and structure. Volunteer tree that leans out to the east, away from the fence and coast live oak no. 839. Tree is under the size requirement for removal permit. Likely a volunteer specimen, buried beneath adjacent, larger canopy tree. Two trunks at ground level with rat nest at base. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 393 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 849 12.00 5.00 17.00 Eucalyptus camaldulensis red gum 30/15 10/10/10 10%-Very Poor Exempt None Retain Out of Work Area 850 7.20 na na Eucalyptus camaldulensis red gum 30/15 30/10/10 10%-Very Poor Exempt None Retain Out of Work Area 851 12.50 8.50 21.00 Eucalyptus camaldulensis red gum 30/15 50/30/20 20%-Very Poor Exempt None Retain Out of Work Area 852 8.00 8 & 7 23.00 Eucalyptus camaldulensis red gum 30/15 30/10/10 10%-Very Poor Exempt None Retain Out of Work Area 853 9.00 na na Eucalyptus camaldulensis red gum 30/10 06/06/06 06%-Very Poor Exempt None Retain Out of Work Area 854 6.50 na na Eucalyptus camaldulensis red gum 30/10 50/30/20 20%-Very Poor Exempt None Retain Out of Work Area 855 6.50 na na Eucalyptus camaldulensis red gum 30/10 60/20/50 20%-Very Poor Exempt None Retain Out of Work Area 856 7.00 na na Eucalyptus camaldulensis red gum 30/10 60/10/50 10%-Very Poor Exempt None Retain Out of Work Area 857 36.00 7.00 43.00 Eucalyptus camaldulensis red gum 70/30 50/20/30 20%-Very Poor Protected None Retain Out of Work Area 858 12.00 9, 7 & 6 34.00 Eucalyptus camaldulensis red gum 40/25 60/40/40 40%-Poor Protected None Retain Out of Work Area 859 12.00 7 & 5 24.00 Eucalyptus camaldulensis red gum 40/10 10/20/40 20%-Very Poor Exempt None Retain Out of Work Area 860 8.50 na na Eucalyptus camaldulensis red gum 25/15 06/06/06 06%-Very Poor Exempt None Retain Out of Work Area 861 7.30 na na Eucalyptus camaldulensis red gum 25/15 06/06/06 06%-Very Poor Exempt None Retain Out of Work Area 862 19.00 8.00 27.00 Eucalyptus camaldulensis red gum 50/25 50/10/20 10%-Very Poor Protected None Retain Out of Work Area 863 30.00 15 & 12.4 57.40 Eucalyptus camaldulensis red gum 65/60 80/50/40 40%-Poor Large Protected None Retain Out of Work Area 864 33.50 na na Eucalyptus camaldulensis red gum 70/40 70/80/80 70%-Good Protected None Retain Out of Work Area Part of volunteer grove. The top has snapped out at approximately 20ft. and there is mechanical damage at the base. Tree is under the size requirement for removal permit. Part of volunteer grove of eucalyptus trees. It grows on a heavy lean and has 2–3ft. of soil built up around the base. Tree is under the size requirement for removal permit. Part of a grove of volunteers. Smaller stem grows on a 90° angle. Growth is stunted under larger canopy trees. Tree is under the size requirement for removal permit. Tree no. 863 and 864 both have their trunks buried. Tree no. 864 is a large specimen tree. There is evidence of large limbs previously removed from the upper canopy. Overall, the tree appears to be in good shape, but has a significant amount of golf ball damage to the trunk. Large, volunteer growing under larger canopy trees. Tree has poor structure with multiple trunks from ground level. Volunteer growing at fenceline.Trunk is buried and the 12in. Main stem appears to be dead. Tree is under the size requirement for removal permit. Appears to be a small stem of what was once a much larger, multi trunk tree. The main trunk failed and the remaining trunk has split again. Recommend removal. Tree is under the size requirement for removal permit. Part of a group of volunteer eucalyptus trees growing at fenceline. Evidence of multiple failures throughout the canopy. Tree is under the size requirement for removal permit. Twin trunks from grade. Evidence of multiple large failures throughout. Located beside creek/swale. Tree no. 863 and 864 both have their trunks buried. Tree no. 863 is a large tree with one main trunk and two smaller branches originating at ground level with good unions. The tree is heavily weighted to one side due to competition of larger trees beside them. Multi trunk tree from ground level, stunted growth, growing at fenceline below larger trees. Base of trunk appears to be buried by rat nest. Tree is under the size requirement for removal permit. Volunteer specimen growing at fenceline, leans heavily out from under larger canopies. Top of tree has snapped off at approximately 30ft. Very poor condition, tree is barely alive-recommend removal. Tree is under the size requirement for removal permit. Young volunteer growing at fenceline, has three trunks with poor unions at 12ft. Tree is under the size requirement for removal permit. Tree no. 855 is a young volunteer growing at fenceline has codominant structure at 20ft., with one side of the tree snapped out. Tree is under the size requirement for removal permit. Young volunteer growing at fenceline.Structure is codominant with a branch embedded in the union at approximately 10ft. Tree is under the size requirement for removal permit. Large, old specimen, growing at fenceline. It has previously lost a few, large scaffold limbs. Notable, large stress fracture appears to have recently formed on the main trunk. This should be monitored. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 394 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 865 12.50 na na Quercus lobata valley oak 28/20 80/80/80 80%-Good Protected None Retain Out of Work Area 866 7.50 7.00 14.50 Eucalyptus camaldulensis red gum 30/20 70/60/50 50%-Fair Exempt None Retain Out of Work Area 867 9.00 na na Quercus lobata valley oak 30/20 70/70/50 50%-Fair Protected None Retain Out of Work Area 868 7.00 na na Quercus ilex holly oak 25/15 70/70/80 70%-Good Protected None Retain Out of Work Area 869 15.50 na na Quercus lobata valley oak 35/25 80/60/70 60%-Fair Protected None Retain Out of Work Area 870 21.20 na na Pinus radiata Monterey pine 65/20 50/50/40 40%-Poor Protected None Retain Out of Work Area 871 14.00 na na Quercus agrifolia coast live oak 30/25 50/70/40 40%-Poor Protected None Retain Out of Work Area 872 28.00 14.00 42.00 Pinus radiata Monterey pine 65/40 80/80/80 80%-Good Protected None Retain Out of Work Area 873 5.00 3.70 8.70 Quercus douglasii blue oak 20/08 65/40/40 40%-Poor Protected None Retain Out of Work Area 874 10.00 5.60 15.60 Quercus douglasii blue oak 25/30 85/80/85 80%-Good Protected None Retain Out of Work Area 875 13.30 9.40 22.70 Quercus lobata valley oak 35/35 85/45/80 45%-Fair Protected None Retain Out of Work Area 876 13.50 na na Quercus agrifolia coast live oak 30/25 75/60/40 40%-Poor Protected None Retain Out of Work Area 877 7.50 na na Quercus agrifolia coast live oak 20/20 50/50/20 20%-Very Poor Protected None Retain Out of Work Area 878 12.00 na na Quercus lobata valley oak 35/30 50/50/30 30%-Poor Protected None Retain Out of Work Area 879 6.00 na na Quercus ilex holly oak 35/10 20/10/10 10%-Very Poor Protected None Retain Out of Work Area 880 12.50 11.5 & 11.5 35.50 Quercus lobata valley oak 40/35 80/60/80 60%-Fair Large Protected None Retain Out of Work Area Young, healthy tree that grows beneath larger canopies of adjacent trees. Young volunteer with twin trunks from 1ft., union is good. Grows on a lean due to larger trees above it. Tree is under the size requirement for removal permit. Young tree that grows on a lean to the north, out from canopies of larger adjacent trees. Young, healthy volunteer-typical of species. Fairly young tree with codominant structure and included bark at 6–7ft. Good form , structure could be corrected overtime. Tree grows on a heavy lean out from beneath larger canopies. Structure is codominant at 10ft. with good union. Young tree that grows on a heavy lean out from below larger canopies. Tall, thin formed tree growing out from larger canopies. The trunk is covered in English ivy; recommend to remove ivy. Young tree with multiple leaders arisingfrom the main union, main leader is dead-no future for this tree-recommend removal. Multiple trunks from 1ft. with good unions. The trunk is covered in English ivy; recommend to remove ivy. Tall, thin specimen that grows on a lean over the neighboring property/house. Structure is codominant at 30–35ft. with fair union. Some large sized deadwood noted in the canopy. Grows on a lean out from larger trees above, canopy appears sparse. Large, older specimen growing at fenceline. Lateral scaffold limb appears to be heavy-could benefit from pruning. Good condition overall. Young tree growing below larger pine tree. Codominant structure at 3ft., majority of growth is to the north, creating asymetrical form. Young, healthy tree with twin trunks from ground level and good union. Young tree with codominant structure. Appears to be splitting at 3ft., structure could be corrected with pruning. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 395 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 881 12.50 na na Quercus lobata valley oak 40/20 30/40/40 30%-Poor Protected None Retain Out of Work Area 882 9.50 na na Quercus lobata valley oak 35/25 80/80/60 60%-Fair Protected None Retain Out of Work Area 883 9.50 na na Quercus lobata valley oak 35/25 20/50/40 20%-Very Poor Protected None Retain Out of Work Area 884 4.40 na na Quercus agrifolia coast live oak 10-Oct 85/85/85 85%-Excellent Protected None Retain Out of Work Area 885 6.60 5.50 12.10 Quercus douglasii blue oak 30/15 50/06/06 06%-Very Poor Protected None Retain Out of Work Area 886 6.00 na na Quercus douglasii blue oak 25/10 50/30/20 20%-Very Poor Protected None Retain Out of Work Area 887 6.00 na na Quercus douglasii blue oak 15-Oct 80/30/10 10%-Very Poor Protected None Retain Out of Work Area 888 9.00 na na Quercus agrifolia coast live oak 25/15 50/50/30 30%-Poor Protected None Retain Out of Work Area 889 6.30 na na Quercus agrifolia coast live oak 25/15 50/50/30 30%-Poor Protected None Retain Out of Work Area 890 7.50 na na Quercus agrifolia coast live oak 30/25 50/50/30 30%-Poor Protected None Retain Out of Work Area 891 14.50 13.3, 12.5,& 7 47.30 Quercus lobata valley oak 35/40 80/45/70 45%-Fair Large Protected None Retain Out of Work Area 892 3.30 2.00 5.30 Quercus agrifolia coast live oak 15/10 90/90/90 90%-Excellent Protected None Retain Out of Work Area 893 17.50 13 & 8 38.50 Quercus lobata valley oak 45/50 85/80/70 70%-Good Large Protected None Retain Out of Work Area 894 18.50 na na Quercus lobata valley oak 35/40 85/80/70 70%-Good Protected None Retain Out of Work Area 895 8.50 8.5 & 3.5 20.50 Quercus agrifolia coast live oak 25/20 50/20/40 20%-Very Poor Protected None Retain Out of Work Area 896 7.80 7.00 14.80 Quercus douglasii blue oak 35/15 80/20/80 20%-Very Poor Protected None Retain Out of Work Area Young tree, grows on a lean due to the competition of adjacent trees. Tree is 75% dead, covered in ivy and grows on a lean due to competition with other trees. Longterm recommend removal. Young, healthy tree-typical for species. Young tree with extremely poor structure that is twisted around itself. There is no long-term future-recommend removal. Young tree that grows on a heavy lean due to competition with adjacent trees young tree growing a 90° lean away from surrounding trees. Tree is 80% dead, trunk is covered in ivy, grows on a lean due to surrounding canopies. Longterm recommend removal. Grows on a natural lean to the north from below, larger canopies. Codominant with included bark from ground level to 1ft., union is poor. The lower canopy has died out possibly from Cryptocline cinerescens (oak twig blight). Ivy at the base, recommend to removal of ivy. Twin trunks from 1ft. and included bark between 2–3ft. Ivy growing at base, structure is poor, form is good. Recommend to remove ivy from base of trunk. Tree no. 888-890 are all young trees growing on lean out from larger blue oak. Tree no. 888-890 are all young trees growing on lean out from larger blue oak. Tree no. 888-890 are all young trees growing on lean out from larger blue oak. Codominant with included bark from ground level. The structure is very poor, form is good. Young, healthy tree-typical for species. Triple trunk tree from ground level. Good overall form and condition, growing in a grove with other oak trees. Recommend pruning to correct structure. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 396 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 897 7.00 7.00 14.00 Quercus douglasii blue oak 35/20 80/20/60 20%-Very Poor Protected None Retain Out of Work Area 898 11.00 na na Quercus douglasii blue oak 35/30 90/90/90 90%-Excellent Protected None Retain Out of Work Area 899 6.50 na na Quercus douglasii blue oak 35/15 80/70/60 60%-Fair Protected None Retain Out of Work Area 900 13.50 10.50 24.00 Quercus lobata valley oak 35/40 85/50/50 50%-Fair Large Protected None Retain Out of Work Area 901 15.20 na na Quercus lobata valley oak 35/30 80/80/50 50%-Fair Protected None Retain Out of Work Area 902 7.50 na na Quercus lobata valley oak 30/10 60/65/50 50%-Fair Protected None Retain Out of Work Area 903 19.50 19, 14 & 9.5 62.00 Quercus lobata valley oak 30/35 80/60/65 60%-Fair Large Protected None Retain Out of Work Area 904 6.00 8.50 14.50 Quercus lobata valley oak 30/20 80/50/65 50%-Fair Protected None Retain Out of Work Area 905 9.80 7 & 5.5 22.30 Quercus lobata valley oak 30/25 80/40/40 40%-Poor Protected None Retain Out of Work Area 906 11.00 8.2, 6.7, 6, 5, 4.8, 4.7 & 3.7 50.10 Quercus lobata valley oak 30/35 80/20/60 20%-Very Poor Large Protected None Retain Out of Work Area 907 10.50 10.00 20.50 Quercus agrifolia coast live oak 25/20 85/20/85 20%-Very Poor Protected None Retain Out of Work Area 908 6.70 4.70 11.40 Quercus douglasii blue oak 25/08 85/70/80 70%-Good Protected None Retain Out of Work Area 909 4.00 3.30 7.30 Quercus douglasii blue oak 20/06 80/10/75 10%-Very Poor Protected None Retain Out of Work Area 910 5.00 4.5, 4.3 & 2.5 16.30 Quercus agrifolia coast live oak 20/15 50/10/70 10%-Very Poor Protected None Retain Out of Work Area 911 12.00 10.50 22.50 Quercus agrifolia coast live oak 35/20 40/30/70 30%-Poor Protected None Retain Out of Work Area 912 5.00 na na Quercus suber cork oak 15/06 85/85/85 85%-Excellent Protected None Retain Out of Work Area Twin trunk tree with included bark at 1ft., recommend reducing the smaller of the two trunks overtime. Heavily growing to the north out from under other trees. Young, tall, thin tree grows out from between canopies of adjacent trees and leans to the east. Codominant structure from ground level with fair union. Form is asymmetrical due to competing canopies. Tree appears to be healthy with overall condition typical of species in a forested area. Young tree in a natural area with brush and ivy growing wild all around. Codominant with included union at 4.5ft. and again at 15ft. Recommend removal of the smaller stem. Triple trunk tree from ground level, may possibly be a regrowth over an old stump. Base of the trunk is covered with ivy. Structure is poor and long-term all three stems will continue to grow away from each. Failure is likely occur, consider removal. Twin trunks from 1ft., form compromised due to crowding by other larger trees. Grows between trees no. 897 and 899. It is the dominant tree between the three and has a good overall condition rating. Smaller tree growing beneath no. 898. Single trunk, good structure, but form is compromised by adjacent trees. Young, recently planted tree. Multi trunk tree from ground level, possibly regrowth from a stump. The trunk is included, appears to be stunted. Form is extremely vase shaped. This tree is growing within a naturalized stand of similar species. Codominant with included bark from ground level, with more codominant unions throughout canopy. Structure is very poor, however, it is in a naturalized stand of other oaks, providing a good screen and serving its purpose. Young blue oak with codominant structure from ground level. Base of tree is surrounded by juniper shrubs. Recommend pruning to reduce from a twin trunk to a single trunk tree while it is young. Young tree that has codominant structure from ground level with included bark throughout. Overall, very poor structure could be pruned over time to correct. Young tree with very poor structure. Multiple trunks from grade, all unions are poor with included bark. Lower canopy foliage appears to have been exposed to chemical overspray or subject to disease/pest. Twin trunk tree with very poor union and decay. Upper canopy has three main leaders. There are hypoxylon fruiting bodies all over the base on the east side, decay, staining and borers around trunk bottom 3–4.ft. The canopy appears to be good, which it is very deceiving. If failure were to occur it could be whole tree failure. Although this tree is not within the work area, highly recommend long term removal. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 397 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 913 11.50 7.30 18.80 Quercus lobata valley oak 25/20 80/80/80 80%-Good Protected None Retain Out of Work Area 914 5.80 3.5 & 3 12.30 Quercus lobata valley oak 20/15 60/60/60 60%-Fair Protected None Retain Out of Work Area 915 7.00 6.5 & 6.5 20.00 Fraxinus uhdei Shamel ash 35/25 80/10/70 10%-Very Poor Protected None Retain Out of Work Area 916 9.00 na na Quercus lobata valley oak 35/15 80/65/50 50%-Fair Protected None Retain Out of Work Area 917 16.20 na na Quercus lobata valley oak 30/10 80/80/80 80%-Good Protected None Retain Out of Work Area 918 7.50 3.50 11.00 Quercus lobata valley oak 20/20 80/70/60 60%-Fair Protected None Retain Out of Work Area 919 19.00 19 & 6 44.00 Quercus lobata valley oak 35/40 85/80/65 65%-Good Large Protected None Retain Out of Work Area 920 5.50 na na Quercus lobata valley oak 15/15 70/50/40 40%-Poor Protected None Retain Out of Work Area 921 30.00 na na Quercus douglasii blue oak 35/40 85/85/85 85%-Excellent Large Protected Low Retain Out of Work Area 922 8.30 na na Quercus agrifolia coast live oak 25/10 85/80/60 60%-Fair Protected Low Retain Out of Work Area 923 5.00 na na Quercus lobata valley oak 15/5 100/100/100 100%- Excellent Protected None Retain Out of Work Area 924 39.00 na na Sequoia sempervirens coast redwood 55/25 70/90/90 70%-Good Photo Protected High Remove 4, 10 (3x)24-in. $35,208.01 925 26.00 20 & 20 66.00 Eucalyptus camaldulensis red gum 60/55 80/06/70 06%-Very Poor Photo Large Protected Low HR 1 (6x)24-in. or (3x)36-in.$3,385.51 926 14.50 na na Eucalyptus polyanthemos red box 30/20 85/10/30 10%-Very Poor Protected Low Retain $1,290.11 927 15.00 14.00 29.00 Eucalyptus camaldulensis red gum 55/25 80/40/50 40%-Fair Protected Low Retain $6,091.03 928 24.00 na na Eucalyptus camaldulensis red gum 55/30 80/60/60 60%-Fair Exempt Low Retain $12,500.36 Young, twin trunk tree with a heavy lean to the north, searching for light. Young tree, growing within a large unmaintained, privet hedge. Structure is codominant at 5ft., with smaller branch of 6in. -recommend removal of smaller branch. Young tree growing inside an unmaintained hedge. Canopy growth is primarily to the north, in search of light-outcompeted by larger canopy trees. Large, older tree with a sprawling canopy, surrounded by privet hedge and growing at property line. Young, tall, skinny tree growing at property line, within privet hedge and under the canopy of no. 921. Tree appears tobe outcompeted and searching for light. Newly planted 60in. box tree. Overall condition is good, typical for species. Fairly young tree growing at the edge of property in a naturalized setting. Structure is codominant from ground level, the union appears fair. Young tree with codominant structure from ground level, union is poor, has included bark. The trunk and canopy are swamped in ivy and out competed by surrounding trees. Recommend removal of ivy, at a minimum. Consider whole tree removal. Young volunteer growing at fenceline. Structure is poor with mulitple trunks and poor unions. Trunk has fence embedded in it and covered in ivy. This is a long-term failure, waiting to happen-recommend removal. Young tree growing at the edge of property. Surrounded by ivy and privet hedges that have been unmaintained, causing tree to grow predominantly to the north. Longterm consider removal. Young, skinny, single trunk, tree growing straight up and out from a grove. Appears to be searching for light with all the foliage at the top of the canopy. Tree that stands alone in the fairway (located south of Tree No. 528.) Canopy is slightly sparse. Tree is located in the backyard/edge of chain-link fence of neighboring property. Structure is poor with three main trunks and included bark. Form is large and sprawling. Two large sized stems have already been removed at some point in time. Failures are evident and the overall structure is extremely poor with high target areas, recommend further inspection. At this time, recommend long term removal or severe pruning to reduce two of the three stems. Single trunk tree growing at fenceline, with majority of canopy to the south. Structure is extremely poor. Secondary leader with included bark has formed in upper canopy. Additional leader has been removed at approximately 15ft. Grows next to the fenceline and is codominant with included bark at 4.5ft. Codominant with included bark at approximately 12ft., recommend pruning for structure. Tree overall has good healthy appearance, fair form and structure. Tree is under the size requirement for removal permit. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 398 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 929 20.00 na na Eucalyptus camaldulensis red gum 60/20 70/10/50 10%-Very Poor Exempt Moderate Retain $1,446.80 930 5.00 na na Sequoia sempervirens coast redwood 18/10 90/80/90 80%-Good Protected Moderate Retain $529.10 931 24.00 na na Eucalyptus camaldulensis red gum 50/30 80/80/80 80%-Good Exempt Low Retain $16,667.15 932 28.50 na na Fraxinus velutina Modesto ash 45/40 10/06/40 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$1,611.59 933 19.50 na na Fraxinus velutina Modesto ash 35/25 10/06/40 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $754.46 934 20.00 na na Fraxinus velutina Modesto ash 45/40 10/10/40 10%-Very Poor Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$1,322.74 935 22.00 na na Fraxinus velutina Modesto ash 45/20 40/06/20 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $960.31 936 26.00 na na Fraxinus velutina Modesto ash 45/35 40/06/20 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$1,341.26 937 24.00 na na Fraxinus velutina Modesto ash 45/20 20/06/10 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $1,142.85 938 28.00 na na Fraxinus velutina Modesto ash 45/40 06/06/50 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$1,555.54 939 24.00 na na Fraxinus velutina Modesto ash 40/50 10/10/30 10%-Very Poor Photo Protected Low Remove 1, 4, 10 (6x)24-in. or (3x)36-in.$1,904.74 940 24.00 na na Fraxinus velutina Modesto ash 45/45 30/40/50 30%-Poor Photo Protected Low Remove 1, 4, 10 (6x)24-in. or (3x)36-in.$5,714.23 941 22.00 na na Fraxinus velutina Modesto ash 45/40 20/06/45 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$960.31 942 26.00 na na Fraxinus velutina Modesto ash 45/40 10/06/40 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (4X) 24-in. or (2x) 36-in.$1,341.26 943 20.00 na na Fraxinus velutina Modesto ash 40/20 06/06/06 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $793.64 944 21.00 na na Fraxinus velutina Modesto ash 40/15 20/06/10 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (3x)24-in. $874.99 Tree in severe decline. Appears to be dying with mistletoe, decay, and dieback throughout. Recommend removal. Same condition as Tree no. 936. This tree has half of canopy left growing to the southeast. Stems are included at 4.5ft. (note: diameter was measured below the split union at 4ft.) Recommend removal. Tree is in decline, has mistletoe in canopy, is actively splitting apart. There is a 6in. wide gap from 4.5ft to ground level). Hazardous-Recommend removal. Tree is in active state of decline, with a large amount of deadwood and falling apart. All growht to the south-due to competition from other trees- recommend removal. Codominant with included bark at 5ft., large amount of deadwood, all growth is to the south-canopy is in competition with others surrounding trees. Recommend removal. All foliage growth is to the south due to competition with other trees. Large amount of deadwood, mistletoe, and galls are persisting in canopy. Structure is poor, codominant within inclusions from ground level to 5.5ft. Evidence of large failures throughout upper canopy. Whole tree failure will occur- recommended removal. Small, young tree developing multiple tops, possibly from being topped at approximately 16ft. Leaders should be corrected with pruning if the tree is to remain. Located in the corner of the property. Overall, condition of tree is good. Tree is under the size requirement for removal permit. Codominant with included bark at 4.5ft. and repeated codominance throughout the canopy. Large sized deadwood, mistletoe and crowding from the adjacent redwood. Tree is cracking at base, and will fail. Recommend removal. Codominant at 5ft., with a third branch that has already been removed from the center. Decay is setting in, whole tree failure probable-recommend removal. Codominant with included bark at 5ft. Noted fungal fruity body in wound (possibly Ganoderma sp.). Tree appears to be in severe decline with several points of branch failure in the upper canopy. Recommend removal. Tree is severe decline, actively splitting in half. Mistletoe in canopy. Recommend removal. Codominant with bulging reaction wood between stem union at 15ft., this is a likely point of failure. The trunk has been damaged by unknown cause (similar to climbing spur marks). Tree is under the size requirement for removal permit. Tree is in active state of decline. Large amount of deadwood and mistletoe in the canopy. Evidence of scaffold limbs failures and associated decay is setting in. Recommend removal. Tree is in active state of decline. Recently pruned to remove larger size deadwood. Decay forming from 0-4.5ft. in the trunk. Note: Diameter was measured below split union @ 4ft. Recommend removal. Tree is in an active state of decline, with half of canopy recently pruned, post failure. Recommend removal. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 399 LRGCC La Rinconada Golf Country Club Tree Inventory and Valuation Appraisal based on 10th Edition Guide for Plant Appraisal Formula: Functional Replacement Method/Trunk Formula Technique Tree No.DBH(in.)DBH Multi(in.)Combined DBH(in.)Species Botanical Name (Genus species)Species Common NameCanopy Height/Spread(ft.)Health/Structure/Form Ratings (0-100%)Overall Condition Ratings (0-100%)PhotoProtectedLarge ProtectedExemptExpected Impact Level Remove, Hazard Remove (HR) or Retain StatusCriteria for Removal Sec. 29.10.0992 & Sec. 29.10.0970Replacement Tree Quantity & Box Size RecommendationAppraisal Value of Protected TreeNotes 945 22.00 na na Fraxinus velutina Modesto ash 45/10 06/06/06 06%-Very Poor Photo Protected Low Remove 1, 4, 10 (2x) 24-in. $960.31 946 32.00 na na Quercus douglasii blue oak 45/50 50/70/70 50%-Fair Large Protected Low Retain $40,393.03 947 $13,458,393 Tree has recently been pruned, same as tree no. 944. Tree is in an active state of decline and failing. Recommend removal. Large sprawling tree that appears to be growing in a moist soil environment and in heavy competition with other trees. No significant trunk flare visible at base, appears slightly buried. Significant amount of deadwood throughout the canopy. Lisa Edwards of Trees 360 Degrees Certified Arborist #WE-5055A Remove = Removal based on development and or condition HR=Hazard Removal Recommended based on condition (additional 47 trees)Updated 07/01/2025 Page 400 La Rinconada Country Club Arborist’s Review June 24, 2025 June 24, 2025 Ryan Safty Community Development Department 110 E. Main Street Los Gatos, CA 95030 I was asked to review the plans and the applicant’s arborist report and provide findings and recommendations. The arborist’s report was provided by Trees 360 Degrees dated April 25, 2025. The report is thorough, complete, and contains all the required information regarding the project. During the site assessment the following questions came up: 1.Tree protection fence materials and potentially the locations and timing. The report states the following: For larger extended areas or areas far enough away from construction impact, it is recommended that heavy-duty, plastic orange barrier construction fencing be used. LRCC would prefer to limit the use of chain link fencing to high-impact areas only if the orange netting is not suitable for adequate protection. The project arborist or Town consulting arborist will determine this on a case-by-case basis. The ordinance states the following: Sec. 29.10.1005. Protection of trees during construction. (a)Protective tree fencing shall specify the following: (1)Size and materials. Six (6) foot high chain link fencing, mounted on two-inch diameter galvanized iron posts, shall be driven into the ground to a depth of at least two (2) feet at no more than ten-foot spacing. For paving area that will not be demolished and when stipulated in a tree preservation plan, posts may be supported by a concrete base. It may be possible to provide a scaled back tree protection material but this will need to be discussed and approved by planning. One option is to have regular monitoring of the fence in lieu of more sturdy fence. Again, since this is in conflict with the ordinance approval for the particular areas and materials will need to be reviewed and approved. Monarch Consulting Arborists LLC - P.O Box 1010, Felton, CA 95018 831.331.8982 - rick@monarcharborist.com Page of 1 2 EXHIBIT 7Page 401 La Rinconada Country Club Arborist’s Review June 24, 2025 2.Tree removals and any bird or wildlife studies. The contractor is responsible for any required biological surveys or reports prior to removing any trees. Nesting birds are protected both locally and through the federal Migratory Bird Treaty Act. 3.Tree removals outside the construction areas but recommended for removal by the consulting arborist (Trees 360 Degrees). I am in agreement with these recommendations but if Trees 360 Degrees performs this work it could be construed as a conflict of interest. The tables in the planning submittal TI-1, TI-2, TI-3, and TI-4 are different than those provided in the report (PDF Pages 34 through 101). The table from the report is more thorough and complete and should replace those in the planning submittal. A proper T-1 sheet needs to be developed and should be broken dow per area for all fence locations during each construction phase. Richard J. Gessner ASCA Registered Consulting Arborist® #496 ISA Board Certified Master Arborist® WE-4341B Tree Risk Assessment Qualified to year 2029 Monarch Consulting Arborists LLC - P.O Box 1010, Felton, CA 95018 831.331.8982 - rick@monarcharborist.com Page of 2 2 Page 402 Monarch Consulting Arborists LLC - P.O Box 1010, Felton, CA 95018 831.331.8982 - rick@monarcharborist.com Page 1 of 2 MEMORANDUM To: Richard Gessner Date: 07/01/2025 From: HMH, Cliff Bechtel, Pinnacle, Origins, Trees360 Job No.: 4545.04 Subject: Response to Monarch Consulting Arborist S-25-005 Planning Memo June 24, 2025 Ryan Safty Community Development Department 110 E. Main Street Los Gatos, CA 95030 I was asked to review the plans and the applicant’s arborist report and provide findings and recommendations. The arborist’s report was provided by Trees 360 Degrees dated April 25, 2025. The report is thorough, complete, and contains all the required information regarding the project. During the site assessment the following questions came up: 1.Tree protection fence materials and potentially the locations and timing. The report states the following: For larger extended areas or areas far enough away from construction impact, it is recommended that heavy-duty, plastic orange barrier construction fencing be used. LRCC would prefer to limit the use of chain link fencing to high-impact areas only if the orange netting is not suitable for adequate protection. The project arborist or Town consulting arborist will determine this on a case-by-case basis. The ordinance states the following: Sec. 29.10.1005. Protection of trees during construction. (a)Protective tree fencing shall specify the following: (1)Size and materials. Six (6) foot high chain link fencing, mounted on two-inch diameter galvanized iron posts, shall be driven into the ground to a depth of at least two (2) feet at no more than ten-foot spacing. For paving area that will not be demolished and when stipulated in a tree preservation plan, posts may be supported by a concrete base. EXHIBIT 8Page 403 Monarch Consulting Arborists LLC - P.O Box 1010, Felton, CA 95018 831.331.8982 - rick@monarcharborist.com Page 2 of 2 MEMORANDUM It may be possible to provide a scaled back tree protection material but this will need to be discussed and approved by planning. One option is to have regular monitoring of the fence in lieu of more sturdy fence. Again, since this is in conflict with the ordinance approval for the particular areas and materials will need to be reviewed and approved. The applicant in consultation with the project arborist has subsequently incorporated a proposal for orange fencing as noted below into the plan set which is also detailed in the final arborist report dated July 1, 2025 along with the justification requested by Planning staff. Page 404 Monarch Consulting Arborists LLC - P.O Box 1010, Felton, CA 95018 831.331.8982 - rick@monarcharborist.com Page 3 of 2 MEMORANDUM 2. Tree removals and any bird or wildlife studies. The contractor is responsible for any required biological surveys or reports prior to removing any trees. Nesting birds are protected both locally and through the federal Migratory Bird Treaty Act. The applicant understands and acknowledges its contractor will be responsible for all required surveys and reports prior to tree removal, and that final approvals will include such conditions. 3. Tree removals outside the construction areas but recommended for removal by the consulting arborist (Trees 360 Degrees). I am in agreement with these recommendations but if Trees 360 Degrees performs this work it could be construed as a conflict of interest. The additional 47 trees recommended by the project arborist have been incorporated into the final arborist report and the updated plan set, both dated July 1, 2025. The tables in the planning submittal TI-1, TI-2, TI-3, and TI-4 are different than those provided in the report (PDF Pages 34 through 101). The table from the report is more thorough and complete and should replace those in the planning submittal. The table in the TI plan sheets 1-11 has been udpated to match the inventory in the final arborist report dated July 1, 2025. A proper T-1 sheet needs to be developed and should be broken dow per area for all fence locations during each construction phase. The applicant has added fence locations and material types (orange vs. Chain-link) to the TP plan sheets as requested. Richard J. Gessner ASCA Registered Consulting Arborist® #496 ISA Board Certified Master Arborist® WE-4341B Tree Risk Assessment Qualified to year 2029 Page 405 This Page Intentionally Left Blank Page 406 1 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com MEMORANDUM Date May 21, 2025 To Ryan Safty, Associate Planner, Town of Los Gatos From Patrick Kallas, Project manager Akoni Danielsen, Principal Project Manager/President Subject La Rinconada Country Club Redesign – CEQA Categorical Exemption Qualification I. Introduction to Categorical Exemptions The California Environmental Quality Act (CEQA) Guidelines contain classes of projects that have been determined not to have a significant effect on the environment and are, therefore, exempt from the provisions of CEQA. CEQA Guidelines Sections 15301 – 15333 constitute the list of categorically exempt projects and contain specific criteria that must be met in order for a project to be found exempt. CEQA Guidelines Section 15301, Existing Facilities Class 1 Categorical Exemptions, and 15302, Replacement or Reconstruction Class 2 Categorical Exemptions set forth conditions for projects which replace or reconstruct existing facilities that may be found categorically exempt. Additionally, CEQA Guidelines Section 15300.2 includes a list of exceptions to exemptions, none of which may apply to a project in order for it to qualify for a categorical exemption (i.e., if an exception applies, a project is precluded from being found categorically exempt). The Town of Los Gatos, serving as the Lead Agency, is completing environmental review for the La Rinconada Country Club Modernization project (“project”) in compliance with CEQA, the CEQA Guidelines (California Code of Regulations Section 15000 et. seq.), and the regulations and policies of the Town of Los Gatos. This Memorandum describes the proposed project and provides analysis and evidence to support a determination by the Town of Los Gatos that the project would be eligible for a Categorical Exemption under CEQA. II. Existing Conditions La Rinconada Country Club was founded by A.P. Giannini in 1928. The first nine holes were completed in 1928 and the second nine later in 1929. Since 1929, modest improvements have been made to the golf course. The Country Club property is accessed by a driveway connecting to Clearview Drive. This access point leads into a 171-space parking lot which serves the clubhouse, y,//dϵPage 407 2 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com country club facilities and golf course. The country club, including the golf course and associated amenities, covers approximately 118.4 acres and is surrounded by residential neighborhoods. The country club also borders the Rinconada Water Treatment Plant on the west. The location and extent of the project area can be seen in Figure 1, 2, and 3. Page 408 Boulder Creek Los Gatos Saratoga Campbell ƵƉĞƌƟŶŽ ^ĂŶ:ŽƐĞ ^ĂŶƚĂ Clara ^ƵŶŶǇǀĂůĞ DŽƵŶƚĂŝŶ sŝĞǁ 880 280 680 280 101 85 85 8717 17 237 Base Map: ESRI, ArcGIS. Project Site PaciĮc Ocean Monterey Bay San JoséSan José SunnyvaleSunnyvale FremontFremontSan MateoSan Mateo Redwood CityRedwood City LivermoreLivermore OaklandOakland San FranciscoSan Francisco Santa CruzSanta Cruz Mountain ViewMountain View Morgan HillMorgan Hill Project SiteProject Site SanFranciscoBay Los GatosLos Gatos Los AltosLos Altos 0 .5 1 2 4 Miles REGIONAL MAP FIGURE 1 Page 409 Pollard Road Knowles Drive University Av e n u eWinchester BoulevardLar k A v e n u eLa R inconada Dr ive Karl AvenueVineland Avenue Daves Avenue Bruce Avenue ConsƟtuƟon Avenue Bicknell RoadMore Aven u eClearview Drive Granada Way R oxbury LaneLos Gatos BoulevardQuito RoadWest Hacienda Avenue Westmont Avenue West Parr Avenue San Tomas Aquinas C reekU.P.R.R. Pollard Road Knowles Drive UniversityAv e nu eWinchester BoulevardLar k A v e n u eLa R inconada Dr ive Karl AvenueVineland Av e n u e Daves Aven u e Bruce Av e n u e ConsƟtuƟonAvenue BicknellRoadMoreAvenue Clearview Drive Granada Wa y R oxbury LaneLos Gatos BoulevardQuito RoadWest Hacienda Avenue Westmont Avenue West Parr Avenue San TomasAquinas C reekU.P.R.R . 85 85 17Los Gatos CreekLosGatosCreekProject Boundary Base Map: ESRI, ArcGIS 0 200 1,200 1,600 2,400 Feet VICINITY MAP FIGURE 2 Page 410 ResidenƟal ResidenƟal ResidenƟal ResidenƟal ResidenƟal ResidenƟal ResidenƟal ResidenƟal Park Church Water Treatment Plant (Closed) Wedgewood AvenueWedgewood AvenueRoxb ury La n e Granada WayGran a da W ay Capistr a n o Pl ace Las Uvas Ct B ick nell Ro a d Karl AvenueMontclair Road Via PintoKarl AvenueVia Del SurEaton Lane Winchester BoulevardLa Rinconada DriveLa Rinconada Driv eGolf Links DriveClearview Drive Wimb ledon D r ive P o l l a r d R o a d West Parr Avenue Pine W o o d L a n e U.P.R.R. Wedgewood AvenueWedgewood AvenueRoxb ury La n e Granada WayGr a n a d a W ay Capistr a n o Pl ac e Las UvasCt B ick nell Ro a d Karl AvenueMontclair Road Via PintoKarl AvenueViaDelSurEaton Lane Winchester BoulevardLa Rinconada DriveLa R inconada Dr ive Golf Links DriveClearview Drive Wimb ledon D r ive P o l l a r d R o a d West Parr Avenue Pine W o o d L a n e U.P. R . R . 85 Photo Date: Aug. 2023 0 100 600 800 1,200 Feet Project Boundary Aerial Source: Google Earth Pro, Feb. 12, 2025. AERIAL PHOTOGRAPH AND SURROUNDING LAND USES FIGURE 3 Page 411 6 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com III.Project Description Proposed Golf Course Modernization The proposed project would modernize the 18-hole layout and replant the entire course by replacing fairways with more drought tolerant Bermuda grasses, adding native drought tolerant trees, and installing a more efficient irrigation system. The adjusted course layout would leave 17 of the 18 holes in their current locations. The only hole location that would be modified would be the 13th hole which would be slightly reoriented on the south side of the project site. All existing on- site structures would remain unchanged and no changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility. Minimal above grade work is planned other than a slight realignment of the entrance drive to improve safety with golf play and a small, approximately 250 square foot, restroom facility for the back 9 holes. Upon project completion, the Country Club would continue to operate one 18-hole golf course on the property and the membership numbers would remain unchanged. The proposed project would not expand or increase the use of any facilities at La Rinconada Country Club. The proposed project would not alter ingress and egress to the property. Irrigation System and Cart Paths As part of the proposed project, the irrigation system would be modernized, on-site drainage systems would be upgraded, and the fairway grass would be replaced with a modern hybrid Bermuda grass that requires 30-35 percent less irrigation water than the current course grass which would reduce irrigation water consumption to approximately 30 million gallons per year. In addition to the turf change and drainage upgrades, the proposed project would replace most of the existing golf course cart paths with reduced footprint cart paths. Replacement of the cart paths would reduce impervious surfaces on the golf course by approximately 70 percent. Tree Removal There are approximately 1,200 trees on the property, most of which are non-native species planted by the Club over the past 50 years. Recently introduced coast redwoods and eucalyptus trees would be replaced by native oaks as a part of the proposed project. The plan would remove approximately 240 trees, most of which are redwoods and eucalyptus. The proposed project would replace the trees removed at a one-to-one ratio, planting approximately 1ϳϯnative tree species on the golf course and payment of in-lieu fees for the remaining tree replacement. Most of the trees proposed for removal are on the interior of the course; only approximately 30 are on the perimeter near homes. This would restore the property to a more natural state similar to the late 1920’s. Construction As part of construction activities, grading would be balanced on-site with approximately 52,780 cubic yards of cut and fill. The area of disturbance is shown in Figure 4, Project Disturbance Area. No Page 412 7 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com soil would be imported to or exported from the site. Construction of the proposed project is estimated to take approximately seven to eight months to complete and is scheduled to begin in early March of 2026. The proposed project would implement standard soil management procedures to limit dust and debris on and around the project site, refer to Condition of Approval in Section IV.(c), Air Quality Effects, below. Construction equipment and materials would be staged on site and construction works would park on site as well during construction. Page 413 275 280 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280 285 290 295 300 305 310 315 320 325 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 350 350 355 360 365 370 375380 350 350 350 355 360 365 370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370370 365 365 355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400 400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330 325 330 335 340 345 350 355 360 365 370 280 285 280 290 295 300 305 310 315 320 285 290 295 300 305 310 285290 295 300305 310 315 320 325 330 335 280 280 275 275 280 38037537036536035535 0 350345335325 340 345 350 355 3453403359 8 7 3 5 6 2 1 12 13 14 15 16 17 10 18 11 36 0 69 67 270 270 275 280 4 AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT40' ROAD EASEMENTLEGEND AREA OF WORK AREA NOT PART OF PROJECT SITE PLAN FIGURE 4 Page 414 9 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com IV. Environmental Review The purpose of this section is to document whether any of the exceptions listed in CEQA Guidelines Section 15300.2 apply to the project, and assess the project’s eligibility for a Categorical Exemption from CEQA under Section 15301, Existing Facilities Class 1 Categorical Exemptions, and 15302, Replacement or Reconstruction Class 2 Categorical Exemptions. Section 15300.2 – Exceptions (a) Location. Classes 3, 4, 5, 6, and 11 are qualified by consideration of where the project is to be located – a project that is ordinarily insignificant in its impact on the environment may in a particularly sensitive environment be significant. Therefore, these classes are considered to apply all instances, except where the project may impact on an environmental resource of hazardous or critical concern where designated, precisely mapped, and officially adopted pursuant to law by federal, state, or local agencies. This exception only applies to Class 3, 4, 5, 6, and 11 exemptions. The proposed project is categorically exempt under Class 1 and/or Class 2; therefore, this exception is not applicable to the project under CEQA Guidelines Section 15300.2(a). (b) Cumulative Impact. All exemptions for these classes are inapplicable when the cumulative impact of successive projects of the same type in the same place, over time is significant. The La Rinconada Country Club has undergone minor revisions for the last 100 years since it was constructed. The timing of these changes has not been close chronologically, therefore, the impacts associated with each modification to the country club would be far enough apart in time to not compound with prior projects. Additionally, the La Rinconada Country Club does not anticipate additional renovations in the near future which may result in cumulative impacts. For these reasons, the proposed modernization of the La Rinconada Country Club would not result in cumulative impacts. (c) Significant Effect. A categorical exemption shall not be used for an activity where there is a reasonable possibility that the activity will have a significant effect on the environment due to unusual circumstances. Air Quality Effects The information in this section is based in part on the Construction Emissions and Health Risk Assessment completed by Illingworth & Rodkin, Inc. This report, which evaluates project emissions to confirm the project complies with General Plan Policy ENV-8.1: Air Quality Standards noted below, is included for reference as Appendix A of the document. The Town of Los Gatos has the following General Plan policies that are applicable to the project. Page 415 10 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com Policy ENV-8.1: Air Quality Standards. Federal, State, and regional air quality goals, policies, standards, and requirements shall be addressed during environmental review for local land use and development decisions. Applicable standards or requirements, if not already in the proposed plans, shall be incorporated as conditions of approval. Policy ENV-8.9: Air Pollution Impacts During Construction. Require project proponents to prepare and implement a construction management plan that incorporates Best Available Control Measures and all best management practices in accordance with the Air District standards to reduce criteria pollutants. General Plan Policy ENV-8.9: Include Bay Area Air Quality Management District (BAAQMD) basic BMPs to control dust and exhaust during construction. During any construction period ground disturbance, the applicant shall ensure that the project contractor implement measures to control dust and exhaust. Implementation of the measures recommended by BAAQMD and listed below would reduce the air quality impacts associated with grading and new construction to a less-than- significant level. x All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day. x All haul trucks transporting soil, sand, or other loose material off-site shall be covered. x All visible mud/dirt track-out onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day. The use of dry power sweeping is prohibited. x All vehicle speeds on unpaved roads shall be limited to 15 miles per hour (mph). x All roadways, driveways, and sidewalks to be paved shall be completed as soon as practicable. Building pads shall be laid as soon as practicable after grading unless seeding or soil binders are used. x All excavation, grading, and/or demolition activities shall be suspended when average wind speeds exceed 20 mph. x All trucks and equipment, including their tires, shall be washed off prior to leaving the site. x Unpaved roads providing access to site located 100 feet of further from a paved road shall be treated with a six - to 12-inch layer of compacted layer of wood chips, mulch, or gravel. Air Quality Construction Emissions Based on the Construction Emissions and Health Risk Assessment, air pollutant emissions associated with project construction were predicted using appropriate computer models. In addition, potential project construction health risk impacts and the impact of existing toxic air contaminant (TAC) sources affecting the existing nearby sensitive receptors (e.g., residents) were evaluated. The air pollutants associated with the construction period include reactive organic gases (ROG), nitrogen oxides (NOx), and particulate matter from exhaust (PM2.5 and PM10). The analysis was conducted following guidance provided by the BAAQMD, the results of which are summarized below in Table 1. Page 416 11 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com The proposed project would require approximately seven months of grading and excavation work (161 days) that would disturb 87.76 acres of ground area. Construction activities would require the operation of heavy construction machinery and would disturb uncovered soil which would create air quality contaminants for the entirety of the construction period. Average daily construction emissions were estimated for the proposed project based on the equipment and operations required for the project. These are summarized in Table 1 below. Table 1 Construction Period Air Pollutant Emissions Year ROG NOx PM10 Exhaust PM2.5 Exhaust 2026 Construction Emissions (Tons) 0.15 1.32 0.04 0.04 2026 Average Daily Emissions (lbs/day) 1.86 16.35 0.50 0.46 BAAQMD Thresholds (pounds per day) 54 54 82 54 Exceed Threshold No No No No Source: Illingworth& Rodkin, Inc. La Rinconada Country Club Redesign Construction Emissions & Health Risk Assessment. February 7, 2025 Based on the emissions expected for the proposed project, the construction activities would not exceed BAAQMD air quality impact thresholds for criteria air pollutants, and therefore the project complies with Policy ENV-8.1, noted above. The proposed project, like virtually all projects which involve ground disturbance, would also generate dust in the form of PM10 and PM2.5 through disturbance and hauling of soils around the site. The project would implement the following Condition of Approval to comply with Policy ENV-8.9 which requires standard best management practices to limit fugitive dust pollutants. Condition of Approval During any construction period ground disturbance, the applicant shall ensure that the project contractor implements measures to control dust and exhaust. Implementation of the measures recommended by BAAQMD and listed below would reduce the air quality impacts associated with grading and new construction to a less-than-significant level. x All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day. x All haul trucks transporting soil, sand, or other loose material off-site shall be covered. x All visible mud/dirt track-out onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day. The use of dry power sweeping is prohibited. x All vehicle speeds on unpaved roads shall be limited to 15 miles per hour (mph). Page 417 12 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com x All roadways, driveways, and sidewalks to be paved shall be completed as soon as practicable. Building pads shall be laid as soon as practicable after grading unless seeding or soil binders are used. x All excavation, grading, and/or demolition activities shall be suspended when average wind speeds exceed 20 mph. x All trucks and equipment, including their tires, shall be washed off prior to leaving the site. x Unpaved roads providing access to site located 100 feet of further from a paved road shall be treated with a six - to 12-inch layer of compacted layer of wood chips, mulch, or gravel. x Publicly visible signs shall be posted with the telephone number and name of the person to contact at the lead agency regarding dust complaints. This person shall respond and take corrective action within 48 hours. The Air District’s General Air Pollution Complaints number shall be visible to ensure compliance with applicable regulations. Therefore, the proposed project would not exceed BAAQMD thresholds for criteria pollutants or fugitive dust and, by implementing the standard measures in Policy ENV-8.9, would have a less than significant effect. Air Quality Health Risk Effects During construction of the proposed project the increase in diesel particulate matter (DPM) and other PM2.5 can result in increased lifetime cancer risk and other health hazards. The construction health risks were modeled for their impacts on existing residences surrounding the site and Roxbury Elderly Care, located west of the site near the northern edge of the golf course. The effects were modeled for impacts on all receptor types (i.e., third trimester, infants, children, and adults). The total modeled DPM was calculated to be 0.04 tons and the fugitive dust was found to be less than 0.01 tons. Based on the modeling conducted for these emissions, the expected construction risk impacts are shown in Table 2 below. Table 2 Construction Risk Impacts at the Off-Site Sensitive Receptors Year Cancer Risk (Per Million) Annual PM 2.5 (micrograms/m3) Hazard Index Project Construction Impacts most affected receiver 2.10 (infant) 0.01 <0.01 Project Construction Impacts at Roxbury Elder Care <0.01 <0.01 <0.01 BAAQMD Single Source Thresholds (pounds per day) >10 >0.3 >1.0 Exceed Threshold No No No Source: Illingworth& Rodkin, Inc. La Rinconada Country Club Redesign Construction Emissions & Health Risk Assessment. February 7, 2025 Page 418 13 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com Based on the health risks associated with the project at the most sensitive receptor, the proposed project would not exceed BAQQMD thresholds, and accordingly, would comply with Policy ENV-8.1, and the project would have a less than significant health risk effect. Noise and Vibration Effects The information in this section is based in part on the Construction Noise and Vibration Assessment completed by Illingworth & Rodkin, Inc. This report is included for reference as Appendix B of the document. Noise Effects The Town of Los Gatos Code of Ordinances Section 16.20.035 limits construction activities to the hours of 8:00 am to 6:00 pm on weekdays and between the hours of 9:00 am and 4:00 pm on Saturdays. No construction is permitted on Sundays or holidays. Section 16.20.035 also states that at least one of the following conditions shall be met: x construction noise limits of 85 dBA at a distance of 25 feet for any single piece of equipment and x noise level at any point outside of the property plane of the project site is limited to 85 A- weighted sound level (dBA) Construction of the proposed project is estimated to take approximately seven to eight months to be completed, beginning in March of 2026. Construction would progress across the country club from hole to hole, and only portions of the property will experience construction activity at any single point in time. In general, the construction activity would last approximately two to four weeks per hole, depending on where the hole is located. The proposed hours of construction are 8:00 am to 6:00 pm on weekdays and 9:00 am to 4:00 pm on Saturdays. No construction would occur on Sundays or holidays. The construction activities that would be a part of the proposed project include earth-moving activities with heavy equipment and hauling of primarily landscape construction materials. Based on this activity, the proposed project would be expected to generate maximum noise levels of 70 to 90 dBA at a distance of 50 feet. A summary of the expected noise levels at receptors within 25 feet of the construction activities is summarized below in Table 3. Page 419 14 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com Table 3 Construction Noise Levels from Heavy Equipment at 25 feet Phase Number of Workdays Construction Equipment (Quantity) Maximum Noise Level dBA Lmax Average Noise Level dBA Leq Site Preparation 120 Tractor/Loader/Backhoe (3)a 90 87 Grading/ Excavation 150 Excavator (10) a Tractor/Loader/Backhoe (3) a 87 90 88 Paving 5 Paver (1)a Paving Equipment (1) Roller (1) Tractor/Loader/Backhoe (3) a 83 83 86 90 87 a Denotes two loudest pieces of construction equipment per phase. Source: Illingworth& Rodkin, Inc. La Rinconada Country Club Golf Course Modernization Project Construction Noise and Vibration Assessment. January 30, 2025 As shown in Table 3, average construction noise levels would range from 87 to 88 dBA Leq when the two loudest pieces of construction equipment operate simultaneously, 25 feet from an individual receptor. These predicted noise levels represent worst-case conditions, and under these conditions, noise levels would be reduced to 84 to 85 dBA Leq if the two loudest pieces of construction equipment per phase operate 35 feet or further from sensitive receptors. Therefore, the construction would conflict with the policy requirement to keep noise below 85 dBA outside the property plane as some places on the 8th, 16th, and 18th holes for the golf course if the two loudest pieces of equipment were operating simultaneously. Therefore, with the following conditions of approval, included in the project, the proposed project would further reduce noise effect during construction. These actions are standard construction measures applied to most construction projects in urban areas. Conditions of Approval x Construction activities shall be limited to the hours of 8:00 a.m. to 6:00 pm on weekdays and between the hours of 9:00 am and 4:00 pm on Saturdays. No construction is permitted on Sundays or holidays. x Equip all internal combustion engine-driven equipment with intake and exhaust mufflers that are in good condition and appropriate for the equipment. x Prohibit unnecessary idling of internal combustion engines. x Locate stationary noise-generating equipment, such as air compressors or portable power generators, as far as possible from sensitive receptors as feasible. If they must be located near receptors, adequate muffling (with enclosures where feasible and appropriate) shall be used to reduce noise levels at the adjacent sensitive receptors. Any enclosure openings or venting shall face away from sensitive receptors. Page 420 15 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com x Locate construction staging areas at locations that will create the greatest distance between the construction-related noise sources and noise-sensitive receptors nearest the project site during all project construction. x Locate material stockpiles, as well as maintenance/equipment staging and parking areas, as far as feasible from residential receptors. x Designate a "disturbance coordinator" who would be responsible for responding to any complaints about construction noise. The disturbance coordinator will determine the cause of the noise complaint (e.g., bad muffler, etc.) and will require that reasonable measures be implemented to correct the problem. Conspicuously post a telephone number for the disturbance coordinator at the construction site and include in it the notice sent to neighbors regarding the construction schedule. The implementation of these reasonable controls would minimize disturbance at existing noise- sensitive receptors in the project vicinity. Additionally, the majority of residences adjacent to the project site are set back further than 35 feet from any work areas and only a small area of the back yards would be exposed to elevated noise levels near the 8th, 16th, and 18th holes for the golf course. Considering that the construction activity would last approximately two to four weeks per hole, and less than one construction season in total, and that the majority of construction would occur more than 35 feet from nearby receptors, the potential temporary exceedances of the Town’s Code of Ordinances for a single piece of equipment over 85 dBA would result in a less than significant effect. Vibration Effect The California Department of Transportation (Caltrans) recommends a vibration limit of 0.5 in/sec peak particle velocity (PPV) for new residential and modern commercial/industrial structures, a vibration limit of 0.3 in/sec PPV for older residential structures, and a vibration limit of 0.25 in/sec PPV for historic buildings. The Town of Los Gatos recognizes a structure as historic if any one of the following apply: x Any structure / site that is located within a historic district x Any structure / site that is historically designated within the LHP overlay x Any primary structure constructed prior to 1941, unless the Town has specifically determined the structure has no historic significance or architectural merit. Based on the Town’s definition of historic structures, this analysis uses a vibration limit of 0.25 in/sec PPV to conservatively assess the potential for vibration impacts because the clubhouse and homes in the surrounding area could be old enough, i.e. prior to 1941, to be considered historic structures. Based on the construction equipment planned to be used for the proposed project, the vibratory levels in Table 4 would be expected. Page 421 16 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com Table 4 Construction Vibration Levels by Phase in in/sec PPV Phase Construction Equipment 5 feet 10 feet 15 feet 20 feet 25 feet Site Preparation Tractor/Loader/Backhoe 0.018 0.008 0.005 0.004 0.003 Grading / Excavation Excavator Tractor/Loader/Backhoe 0.446 0.018 0.208 0.008 0.133 0.005 0.097 0.004 0.076 0.003 Paving Paver Paving Equipment Roller Tractor/Loader/Backhoe 0.018 0.018 1.233 0.018 0.008 0.008 0.575 0.008 0.005 0.005 0.368 0.005 0.004 0.004 0.268 0.004 0.003 0.003 0.210 0.003 Source: Illingworth& Rodkin, Inc. La Rinconada Country Club Golf Course Modernization Project Construction Noise and Vibration Assessment. January 30, 2025 The proposed project could exceed vibratory impact levels if vibratory rollers are used within 20 feet of vibration sensitive buildings built before 1941. To reduce any potential vibration effects the following Conditions of Approval are expected for the proposed project. Condition of Approval x Smaller equipment (less than 18,000 pounds) shall be used near the property lines adjacent to the residential buildings to minimize vibration levels. For example, a smaller vibratory roller similar to a Caterpillar model CP433E vibratory compactor could be used when compacting materials within 25 feet of vibration-sensitive buildings. x Small tractors/loaders/backhoes shall be used within 10 feet of vibration-sensitive buildings instead of excavators. x Designate a Disturbance Coordinator responsible for registering and investigating claims of excessive vibration. The contact information of such person shall be clearly posted on the construction site. Based on the distance of residential structures from the edge of the golf course and the location of construction activities on the project site, the vibratory equipment would not be used for long periods of time near any structure which could be damaged by vibration along the 8th, 16th, and 18th holes of the golf course. Therefore, by implementing the best management practices above, primarily around the clubhouse area, the proposed project would result in less than significant vibratory effect during construction. Biological Effects The proposed project would disturb up to approximately 87.76 acres of vegetated areas landscaped for use as a golf course. This includes non-native grasses covering a majority of the area and trees lining the golf course hole boundaries. The site is not mapped as habitat for special status plants or Page 422 17 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com animals, and does not contain regulated habitats, i.e. riparian areas or wetlands or waters of the US or the state, as the ornamental ponds are man-made features subject to regular irrigation and maintenance. The proposed project would remove and replace this landscaping which would disturb any animals that are using the trees or other landscaped areas as habitat. Additionally, the proposed project would be required to comply with the Tree Replacement Standards identified in Table 3-1 of the Town of Los Gatos Zoning Regulations. The proposed project would remove up to 240 trees across the golf course area. The full list of trees removed as a part of the project is included in Appendix C. To protect birds that may be nesting in the trees, the project would implement standard nesting survey requirements as required by the Migratory Bird Treaty Act and California Department of Fish and Wildlife Code. These requirements are summarized below. Through inclusion of this standard condition of approval the project would avoid negative effects on birds. Condition of Approval x Construction shall be scheduled to avoid the nesting season to the extent feasible. The nesting season for most birds, including most raptors, in the San Francisco Bay Area extends from February 1st through August 31st. If it is not possible to schedule construction and tree removal between September 1 and January 31, then pre-construction surveys for nesting birds shall be completed by a qualified ornithologist to ensure that no nests are disturbed during project implementation. This survey shall be completed no more than 14 days prior to the initiation of grading, tree removal, or other construction activities during the early part of the breeding season (February through April) and no more than 30 days prior to the initiation of these activities during the late part of the breeding season (May through August). During this survey, the ornithologist shall inspect trees and other possible nesting habitats within and immediately adjacent to the construction area for nests. If an active nest is found sufficiently close to work areas to be disturbed by construction, the qualified ornithologist, in consultation with California Department of Fish and Wildlife (CDFW), shall determine the extent of a construction-free buffer zone to be established around the nest to ensure that raptor or migratory bird nests shall not be disturbed during project construction. (d) Scenic Highways. A categorical exemption shall not be used for a project which may result in damage to scenic resources, including but not limited to, trees, historic buildings, rock outcroppings, or similar resources, within a highway officially designated as a state scenic highway. This does not apply to improvements which are required as mitigation by an adopted negative declaration or certified EIR. Page 423 18 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com There are no officially designated state scenic highways in the project area. The nearest officially designated state highway is State Route 9, which is located approximately 1.25 miles southwest of the project site and is not visible from the project site.1 The project, therefore, would not damage scenic resources within a highway officially designated as a state scenic highway, and no exception to the exemption applies under 15300.2(d). (e) Hazardous Waste Sites. A categorical exemption shall not be used for a project located on a site which is included on any list compiled pursuant to Section 65962.5 of the Government Code. The provisions in California Government Code Section 65962.5 are commonly referred to as the “Cortese List”. Properties considered to be on the Cortese List include current and closed leaking underground storage tank (LUST) case sites, in addition to sites with other hazardous conditions. The California Government Code does not provide a provision for the removal of an affected property from the Cortese List. Therefore, even properties with closed LUST cases in which no further work is required are still considered to be on the Cortese List. The project site is recorded on the Cortese List Geotracker database for two closed LUST cases, which are associated with an area of the site in which no work is proposed. Due to the case closure, and to confirm if there are any hazards present on the portion of the site where the proposed golf course modernization would occur, Cornerstone Earth Group prepared a memorandum to evaluate the status of the closed LUST cases and the potential for the proposed project to disturb areas covered by the closed LUST cases.2 Based on the case information, a 500-gallon gasoline underground storage tank (UST) was removed from the Site in 1993. In 1998, an additional 500-gallon diesel UST and a 1,000-gallon gasoline UST were removed. All three USTs were located at the golf course maintenance facility on the furthest southern portion of the project site, a small triangular area southeast of the 16th and 17th holes that is not included within the area of proposed modernization work. As a part of the case closure, sampling was conducted at the location of each of the three USTs. Soil and groundwater samples detected only low concentrations of petroleum hydrocarbons, diesel range petroleum hydrocarbons, and xylene. These detected concentrations did not exceed current residential or commercial environmental screening levels (ESLs). The associated LUST cases were closed by the Santa Clara Valley Water District (SCVWD) in 1997 and 1998. While the LUST cases technically remain on the Cortese list for record keeping, the maintenance facility area which includes the area of the closed LUST cases, is not part of the golf course renovation plan. In addition, based on the Grading Plan, no earthwork activities are planned near 1 California Department of Transportation. “California State Scenic Highway System Map”. Accessed January 15, 2025. https://caltrans.maps.arcgis.com/apps/webappviewer/index.html?id=465dfd3d807c46cc8e8057116f1aacaa. 2 Cornerstone Earth Group, Inc. Environmental Review La Rinconada Country Club Golf Course Renovation. January 9, 2025. Page 424 19 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com the maintenance facility area and former UST locations at the golf course maintenance facility. Thus, the former UST locations should not have an adverse impact on the planned golf course renovation work, and no exception to the exemption applies under 15300.2, as there are no current conditions affecting the property that warrant inclusion on the Cortese list.3 (f) Historical Resources. A categorical exemption shall not be used for a project which may cause a substantial adverse change in the significance of a historical resource. The project site is a country club which was established in 1928, approximately 97 years ago. The golf course was modified in 1989, including reconstruction of greens, replanting of grasses, regrading of some fairways, and changes to drainage of the course. The property is not included on the California Register of Historic Places, nor has it been determined eligible for listing on the California Register by the State Historical Resources Commission. The country club is also not identified in the Los Gatos General Plan as a registered historic place, nor has it been identified by the County of Santa Clara in its historic register as a historic property. Therefore, the property is not considered a mandatory historic resource under Guidelines Section 15064.5(a)(1) or a presumptive historic resource under Section 15064.5(a)(2). The proposed project would primarily replace the grass and some trees on the project site and would only require the relocation of one golf hole for the country club. This improvement would be similar to the improvements conducted in the 1990’s and would not change any of the uses of the country club facilities. No physical changes are proposed to the clubhouse or any other structures. Therefore, given the property is not listed as a historic resource by the state, county, or Town of Los Gatos, the modifications proposed as a part of the modernization project would not create a change in the significance of any historic resource. Section 15301 – Existing Facilities Section 15301, or Class 1, applies to projects consisting of the operation, repair, maintenance, permitting, leasing, licensing, or minor alteration of existing public or private structures, facilities, mechanical equipment, or topographical features, involving negligible or no expansion of existing or former use. The key consideration is whether the project involves negligible or no expansion of use. These conditions, along with the project’s consistency with them, are described below. The proposed modernization project would encompass grading of the site and reconstruction of the golf course which would reduce the water consumption on-site and allow for greater water infiltration due to reduced impervious surfaces. The changes to the golf course area would not expand the number of players, the frequency or magnitude/intensity of events, or overall utility of the project site. Therefore, the proposed project would not result in an expansion of use and would 3 California Environmental Protection Agency. “Cortese List Data Resources”. Accessed January 15, 2025. https://calepa.ca.gov/sitecleanup/corteselist/. Page 425 20 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com only perform minor alteration of the existing facility and would meet the requirements for a Section 15301 exemption. Section 15302 – Replacement and Reconstruction Section 15302, or Class 2, applies to projects consisting of replacement or reconstruction of existing structures, facilities where the new structure will be located on the same site as the structure replaced and will have substantially the same purpose and capacity as the structure replaced. These conditions, along with the project’s consistency with them, are described below. The proposed project would regrade the golf course area of the project site and reorganize the golf course layout. The reorganization of the site would construct the same uses within the existing boundary of the facilities of the country club. Additionally, the proposed project would not alter any of the structures on site other than a minor realignment of the primary access road for the project site and a new 250-square foot bathroom structure in the middle of the course. Therefore, the proposed project would be consistent with the conditions for a Section 15302 exemption because the country club would replace the existing course area in kind, and would not change the purpose or capacity of the La Rinconada Country Club. V. Conclusion As documented in Section IV. Environmental Review, with the incorporation of the City’s standard conditions of approval, none of the exceptions contained in CEQA Guidelines Section 15300.2 apply to the project and the project is consistent with the criteria in CEQA Guidelines Section 15301 and 15302. The project, therefore, qualifies as exempt from the provisions of CEQA under Class 1 and Class 2 of the CEQA Guidelines. Page 426 21 1871 The Alameda, Suite 200 x San José, CA 95126 x Tel: (408) 248-3500 x www.davidjpowers.com APPENDICES Appendix A: Construction Emissions and Health Risk Assessment Appendix B: Construction Noise and Vibration Assessment Appendix C: Arborist Tree Inventory Appendix D: Environmental Review La Rinconada Country Club Golf Course Renovation Page 427 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 · WRA #350018 MEMORANDUM TO: Patrick Kallas, David J. Powers and Associates pkallas@davidjpowers.com FROM:Daniel Elting, WRA, Inc. daniel.elting@wra-ca.com CC: Andy Kimball, La Rinconada Country Club akimball@Larinconadacc.com DATE: Revised April 18, 2025 SUBJECT:La Rinconada Country Club Redesign Project Biological Constraints Assessment 1.0 PURPOSE The purpose of this memorandum is to provide an analysis of biological resources at the La Rinconada Country Club (Study Area) in Los Gatos, Santa Clara County, California. The report is intended to support a review of the La Rinconada Country Club Redesign Project (Project) per the California Environmental Quality Act (CEQA). As part of that review, the memorandum addresses potential Project affects in accordance with Appendix G of the CEQA guidelines. Provided herein are descriptions of habitats present, and a discussion of potential environmental constraints. 2.0 BACKGROUND AND EXISTING CONDITIONS The La Rinconada Country Club (Study Area) is an approximately 129-acre complex which includes an 18-hole golf course, tennis courts, private recreation areas, ornamental ponds, pools, and other buildings and facilities. The Study Area is situated approximately 0.25 miles south of Highway 85 within an urbanized area in Los Gatos, California with private access driveways to the east from Clearview Drive and La Rinconada Drive. The Study Area is surrounded on all sides by residential development. The site has been used for recreation since the late 1920’s and contains a network of well-maintained paved roads and pathways throughout the site. 3.0 PROJECT DESCRIPTION The proposed Project will be composed of a redesign of the existing golf course on site. Golf course modifications will be implemented through scattered earthwork on approximately 37 acres of existing course holes and ornamental ponds (Project Area; Figure 1). Additional Project components will include upgrades to irrigation systems and concrete pathways, turf lawn replacement, and removal and replacement of approximately 190 trees within the Project Area. Following the completion of construction, the proposed land-use will be equivalent to the existing use as recreation. Page 428 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 2 3.1 Project Layout The Project would incur only slight changes modifications in grade of the existing golf course and make no major modifications in existing land cover. All existing on-site structures would remain unchanged but two ornamental ponds will be de-watered and re-graded to slightly different specifications. Upon project completion, the Country Club will continue to operate one 18-hole golf course and the membership capacity will remain unchanged. The Project would not expand or increase the use of any facilities at the Country Club, nor alter ingress and egress routes to the property. A Project Master Plan including Grading limits are provided in Attachment A.. 3.2 Irrigation System and Cart Paths As part of the proposed Project, the existing irrigation system will be modernized, existing drainage systems will be upgraded, and the fairway grass will be replaced with hybrid bermudagrass (Cynodon dactylon); the hybrid bermudagrass will require 35 percent less irrigation water than the current course grass. In addition to the turf change and drainage upgrades, the Project would reduce the number of existing golf course cart paths which will decrease the impervious surface area on the golf course by approximately 70 percent. 3.3 Tree Removal There are approximately 1,200 trees on the property, most of which are non-native species planted by the Country Club over the past 50 years. A total of 256 trees will be removed as part of the Project; most of which are recently planted redwoods (Sequoia sempervirens) and eucalyptus (Eucalyptus sp.) trees. The Country Club will obtain all necessary permits associated with the removal of trees including heritage trees as defined by the City of Los Gatos (City) Code of Ordinances. Removed trees will be replaced at a 1:1 ratio by native oak trees (Quercus sp.) or other regionally appropriate native tree species. Details for trees to be removed and a proposed re-planting plan to City compliance are provided in Attachment A. 3.4 Construction As part of construction activities, grading would be balanced on-site with approximately 60,000 cubic yards of cut and fill. No soil would be imported to or exported from the site. Construction of the proposed Project is estimated to take approximately seven months to complete and is scheduled to begin in March of 2026. Page 429 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 3 4.0 METHODS This evaluation is based on a review of literature and database sources as well as a site visit completed by WRA, Inc. (WRA) on January 24, 2025. Prior to the site visit, WRA biologists reviewed literature resources and performed database searches to assess the potential for sensitive land cover types (e.g., wetlands) and special-status species (e.g., endangered plants), including: x SoilWeb (CSRL 2025) x Contemporary aerial photographs (Google Earth 2025) x Historical aerial photographs (NETR 2025) x National Wetlands Inventory (USFWS 2025a) x California Natural Diversity Database (CNDDB; CDFW 2025a) x California Native Plant Society Rare Plant Inventory (CNPS 2025a) x Consortium of California Herbaria 2 (CCH2 2025) x USFWS Information Planning and Consultation database (USFWS 2025b) x eBird Online Database (eBird 2025) x California Bird Species of Special Concern in California (Shuford and Gardali 2008) x California Amphibian and Reptile Species of Special Concern (Thomson et al. 2016) x A Field Guide to Western Reptiles and Amphibians (Stebbins 2003) x A Manual of California Vegetation, Online Edition (CNPS 2025b) x California Natural Community List (CDFW 2025) On January 24, 2025, WRA biologists Daniel Elting and Maya Avendano conducted a field assessment of the 129-acre Study Area to observe conditions for the presence of sensitive land cover types and the potential to support habitat for special-status plant and wildlife species. Potentially jurisdictional areas and sensitive habitats were mapped using a combination of mapping-grade GPS devices and hand-drawn boundaries on high-resolution aerial imagery. 5.0 RESULTS 5.1 Vegetation Communities and Other Land Cover WRA observed six land cover types within the Study Area. Non-sensitive land cover types include developed and ornamental ponds, and potentially sensitive land covers include intermittent stream, seasonal wetland swale, oak woodland and riparian woodland. Land cover types within the Study Area are mapped in Figure 1. Page 430 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 4 5.1.1 Non-Sensitive Land Cover Types DEVELOPED Developed areas comprise the majority of the Study Area and consist of meticulously maintained fairway lawns and putting greens, sand bunkers, paved roads and concrete areas, buildings, swimming pool facilities, and ornamental landscaping. Mowed lawns are fields of non-native turf grasses with scattered non-native forbs such as English plantain (Plantago lanceolata), common sowthistle (Sonchus oleraceus), with planted stands of coast redwoods, coast live oaks (Quercus agrifolia), valley oak (Quercus lobata), and eucalyptus. This land cover type is not considered sensitive by any regulatory entities. ORNAMENTAL PONDS The Study Area contains two manmade ornamental ponds which were created sometime in the mid 1960’s and 1970’s (NETR 2025). The ponds are managed and filled with water year-round. The banks of the ponds are artificially hardscaped with rocks and concrete, with some areas having a more gradual, vegetated bank. While minimal, there are some areas on the fringes of the ponds with sparse, emergent aquatic vegetation encroaching into the water from the bank. The ponds were created through excavation of dry land and artificially filled with diverted water. These water features are unlikely to be recognized as sensitive by federal or state agencies. Sensitive Habitats. 5.1.2 Sensitive Habitats INTERMITTENT STREAM An intermittent stream flows from south to north in the central portion of the Study Area into an artificial drain. Intermittent streams exhibit flow during portions of the year but do not convey water during the dry season. The stream ordinary high- water mark (OHWM) was determined by scour, water staining, debris build up, and changes in vegetation. Flowing water was present in the stream at the time of the January 24, 2025, site visit. The stream is surrounded by riparian woodland vegetation including arroyo willow (Salix lasiolepis) and curly dock (Rumex crispus). Intermittent stream may be considered sensitive by the California Department of Fish and Wildlife (CDFW), Regional Water Quality Control Board (RWQCB), and the United States Army Corps. of Engineers (Corps.) Photo 1. Developed land cover in the Study Area is largely dominated by mowed lawns and paved cart paths. Photo 2. Southeast ornamental pond in the Study Area. Photo 3. Intermittent stream, with banks mapped based on scour and erosion from water flow. Page 431 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 5 RIPARIAN WOODLAND Riparian woodland occurs in the central portion of the Study Area adjacent to the main office building of the Country Club. Riparian habitat consists of woody-species-dominated vegetation that grows because of, or contributes organic material to, the intermittent stream within the Study Area. Riparian woodland is primarily dominated by coast live oak, with ash trees (Fraxinus sp.), elderberry (Sambucus sp.) and willows (Salix sp.) co-dominant. Poison oak (Toxicodendron diversilobum)and French broom (Genista monspessulana) largely dominate the midstory, with sparse herbs growing through the leaf litter, such as Italian arum (Arum italicum). Riparian woodland land cover type is considered sensitive by CDFW. The Project Area will not be within Riparian Woodland and no affects or disturbance to Riparian Woodland will occur. SEASONAL WETLAND SWALE A potential seasonal wetland exists in the central portion of the Study Area in a heavily modified drainage area immediately north of the central ornamental pond. The wetland serves as a drainage basin for coneyance structures to both the north and south. South of the wetland an artificial swale drains into the wetland from the nearby pond. North of the wetland a culvert outlet drains into the wetland originating from underground segments of stormwater conveyance beneath roadways. Some inundation was present in the wetland during the January 24, 2025 site visit near the northern most culvert. Vegetation in the seasonal wetland swale was dominated by wetland plants including cattail (Typha sp.), watercress (Nasturtium officinale), curly dock (Rumex crispus), and pale knotweed (Persicaria lapathifolia). Boundaries of the potential seasonal wetland were mapped based on changes in dominant vegetation and topography but were not formally assessed for the three wetland parameters used by the Corps. to delineate wetland boundaries. This seasonal wetland is unlikely to meet the definition of Waters of the U.S. by the Corps. but may be considered sensitive by CDFW and the RWQCB. Photo 5. Seasonal wetland swale in the Study Area. Photo 4. Riparian woodland associated with the intermittent stream in the Study Area. Page 432 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 6 Oak Woodland The western portion of the Study Area contains a stand of valley oak woodland surrounding a private park/recreation area with trails and tennis courts. This habitat primarily contains valley oak with sparse blue oak (Quercus douglasii) with minimal understory due to regular mowing and maintenance of walking trails. Oak woodland and associated trees may be considered sensitive at state and local levels. 6.0 SPECIAL-STATUS SPECIES 6.1 Special-status Plant Species Based upon a review of the resource databases listed in Section 3.0, 76 special-status plant species have been documented in the vicinity of the Study Area. All special-status plant species are unlikely or have no potential to occur within the Study Area because suitable conditions are lacking (e.g., edaphic [soil] conditions, topography, unique pH, associated natural communities, low levels of disturbance). No special-status plant species were observed within the Study Area on the January 24, 2025 survey. 6.2 Special-status Wildlife Species Based upon a review of the resource databases listed in Section 4.0, 40 special-status wildlife species have been documented in the vicinity of the Study Area. Of these species, most are excluded based on a lack of habitat features (e.g., tidal marsh, old growth redwood or fir forest, grassland, sandy beaches or alkaline flats, and the presence of specific host plants). Additional species are excluded due to the lack of hydrological connection with streams that could support breeding populations of amphibians, and absence of quality foraging habitat within the Study Area. As such, most special-status wildlife species documented from the vicinity do not have the potential to occur within the Study Area. 6.2.1 Species Discussion Northwestern Pond Turtle (NWPT; Actinemys marmorata) is a federally proposed threatened reptile that is known to occur within the vicinity of the Study Area. The nearest recorded occurrence of pond NWPT is in the Vascona Reservoir approximately 0.75 miles southeast of the Study Area (CNDDB 2024). Within the Study Area, the southeast ornamental pond provides potential habitat for NWPT due to the presence of minimal aquatic foraging vegetation and sparse basking sites in the form of above-surface rocks. However, the surrounding urban areas, heavy human disturbance, and fragmentation of suitable aquatic corridors surrounding the Study Area make the potential for establishment of pond turtles low. No NWPT were observed on the January 24, 2025 survey and they were determined to be unlikely to occur in the Study Area. Photo 5. Oak woodland in western portion of the Study Area. Page 433 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 7 San Francisco dusky-footed woodrat (SFDFWR; Neotoma fuscipes annectens)is a regional subspecies of dusky footed woodrat that is a CDFW Species of Special Concern. SFDFWR use habitats with dense canopy cover including oak woodland, chaparral, and riparian woodlands. Mound shaped dens or “middens” are constructed by SFDWR using large twigs and occasionally anthropogenic items such as trash or debris (Kelly 1990). The nearest recorded occurrence of SFDWR is approximately 7 miles north of the Study Area along Saratoga Creek in Cupertino, California. During the site visit on January 24, 2025, three San Francisco dusky- footed woodrat nests were observed within riparian woodland surrounding the intermittent stream in the northeast portion of the Study Area. The presence of presumed active dens within the Study Area indicates that SFDFR are present in the Study Area. However they are only present within Riparian Woodland areas which are to be completed avoided by Project activities. 6.2.2 Protected Nesting Birds and Roosting Bats species protected by the Migratory Bird Treaty Act (MBTA) as well as by California Fish and Game Codes (CFGC) have potential to nest in trees, vegetation, or on structures within or adjacent to the Study Area. No active nests were observed in the January survey as the survey was outside of the breeding season of most species (Feb – Sep). Additionally, no inactive raptor nest structures from previous seasons were observed in any of the trees on site. Additionally special-status bats including CDFW Species of Special Concern (SSC) Townsend’s big-eared bat (Corynorhinus townsendii,) and pallid bat (Antrozous pallidus) have a potential to roost in mature trees in the Study Area, although the frequent level of day-time disturbance make this unlikely. Photo 6. SFDFN den discovered in riparian woodland habitat. Den constructed atop an abandoned shipping pallet. Page 434 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 8 7.0 ANALYTICAL METHODOLOGY AND SIGNIFICANCE THRESHOLD CRITERIA Pursuant to Appendix G, Section IV of the State CEQA Guidelines, a project would have a significant affect on biological resources if it would: a) Have a substantial adverse effect, either directly or through habitat modifications, on any species identified as a candidate, sensitive, or special-status species in local or regional plans, policies, or regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service. b) Have a substantial adverse effect on any riparian habitat or other sensitive natural community identified in local or regional plans, policies, regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service. c) Have a substantial adverse effect on federally protected wetlands as defined by Section 404 of the Clean Water Act (including, but not limited to, marsh, vernal pool, coastal, etc.) through direct removal, filling, hydrological interruption, or other means. d) Interfere substantially with the movement of any native resident or migratory fish or wildlife species or with established native resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites. e) Conflict with any local policies or ordinances protecting biological resources, such as a tree preservation policy or ordinance. f) Conflict with the provisions of an adopted Habitat Conservation Plan, Natural Community Conservation Plan, or other approved local, regional, or state habitat conservation plan. These thresholds were utilized in completing the analysis of potential Project affects for CEQA purposes. For the purposes of this analysis, a “substantial adverse effect” is generally interpreted to mean that a potential affect could directly or indirectly affect the resiliency or presence of a local biological community or species population. Potential affects to natural processes that support biological communities and special-status species populations that can produce similar effects are also considered potentially significant. Affects to individuals of a species or small areas of existing biological communities may be considered less than significant if those affects are speculative, beneficial, de minimis, and/or would not affect the resiliency of a local population. 8.0 POTENTIAL AFFECTS AND AVOIDANCE MEASURES The purpose of this assessment is to evaluate the potential affects of Project construction and operation on existing conditions for biological resources within the Project Area. This section is structured to specifically address each significance threshold for biological resources from CEQA Appendix G. Recommendations for avoidance and minimization measures are detailed for affects that area determined to be potentially significant (Table 1). Page 435 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 9 Table 1: Summary of Potential to Affect and Minimization CEQA Assessment Category IV.- Biological Resources Biological Resources Considered Potentially significant affects Summary of avoidance measures Question A. Special- status species Special-status Plants Special-status Wildlife Designated Critical Habitat Project may affect federal federally proposed northwestern pond turtle Project may affect San Francisco dusky footed woodrats or their dens, a California Species of Special Concern (SSC) Project may affect nesting birds protected by the CFGC by destroying active nests or causing disturbance that results in nest abandonment. Project may affect special- status and non-status roosting bats by destroying active roosts or causing disturbance that results in roost abandonment. Pre-construction wildlife survey in ornamental ponds prior to de-watering or grading. Turtles to be re-located by a USFWS approved biologist to nearby suitable habitat if observed. SFDFR are presumed present on site in the riparian woodland habitat, this area will not be affected by project activities and so there will be no affect. If construction activities cannot be avoided during nesting (February 1-August 31). Pre- construction bird surveys within 500 feet of construction area within 14 days of initial ground disturbance or vegetation removal. If nests of protected avian species are present, no-work exclusion zones around any active protected nest until all young have fledged or are independent of nest. Avoid tree removal activities during bat maternity season (April-October). Pre-construction bat surveys within 14-30 days of initial ground disturbance or veg removal. Regardless of timing of tree removal or trimming, allow all felled trees and large limbs to remain on the ground for at least 24 hours. Question B. Sensitive natural communities & riparian habitat Sensitive Natural Communities Streams, Lakes, & Riparian Habitat No affect, the Project footprint does not include any sensitive habitat mapped within the greater Study Area. Not applicable. Page 436 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 10 CEQA Assessment Category IV.- Biological Resources Biological Resources Considered Potentially significant affects Summary of avoidance measures Question C. State and federally protected wetlands Wetlands Unvegetated surface waters No affect, the Project footprint does not include any of the wetlands or waters mapped within the greater Study Area. Not applicable. Question D. Fish & wildlife corridors Essential Fish Habitat Wildlife Corridors No affect, no EFH or wildlife corridors present in the Study Area Not applicable. Question E. Local policies Protected Trees Other biological protections No affect because the Project will obtain a use and grading permit as well as a tree removal permit from the City of Los Gatos. Not applicable. Question F. Local, state, federal conservation plans Habitat Conservation Plans No affect, the Project is outside of the Santa Clara County Habitat Plan Boundary. Not applicable. 8.1 Project Affect and Minimizatino Evaluation for Special-status Species 8.1.1 Special-Status Wildlife This section analyzes the Project’s potential effects and potential minimization measures for special-status species in reference to the significance threshold outlined in CEQA Appendix G, Part IV (a): a)Does the project have the potential to have a substantial adverse effect, either directly or through habitat modifications, on any species identified as a candidate, sensitive, or special-status species in local or regional plans, policies, or regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service? Potential for potentially significant effects to special-status species are discussed below. Potential Affect BIO-1:The southeastern ornamental pond has limited potential to support northwestern pond turtle, a federal proposed species. While no turtles were observed on the January 2025 site visit, there are sparse basking sites in the form of above surface rocks, but corridors for turtles to reach the ponds are virtually absent. To reduce potential effects to northwestern pond turtle to a less-than-significant level, the following measures shall be implemented: Page 437 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 11 Avoidance Measure BIO-1: Prior to de-watering or grading of existing ornamental ponds, a qualified biologist shall conduct a pre-activity survey of the ponds to ensure no NWPT are present and will be affected. If turtles are discovered, a federally- approved biologist shall capture and re-locate the turtles to nearby suitable habitat in consultation with the United States Fish and Wildlife Service (USFWS). NESTING BIRDS Special-status and non-status nesting birds protected under the CFGC have the potential to nest in trees, shrubs, herbaceous vegetation, and on bare ground and man-made structures within and adjacent to the Project Area Project construction activities have the potential to affect nests in these areas if construction is initiated during the breeding bird season (typically February 1 through August 31). Potential effects include direct destruction of nests as well as indirect visual and acoustic disturbance to nesting birds from construction in adjacent areas that have the potential to result in nest abandonment. Destruction of nests or indirect disturbance from construction that results in nest abandonment are considered potentially significant affects under CEQA. Potential Affect BIO-2: Project construction activities have the potential to directly or indirectly affect special-status nesting birds and other native nesting birds protected by the MBTA and CFGC. Construction could directly destroy active nests or cause disturbance that results in nest abandonment. To reduce potential for affecting nesting birds to a less-than-significant level, the following measures shall be implemented: Avoidance Measure BIO-2:Initiation of construction activities during the avian nesting season (typically February 1 through August 31) will be avoided to the extent feasible. If construction initiation during the nesting season cannot be avoided, pre- construction nesting bird surveys will be conducted within 14 days of initial ground disturbance or vegetation removal to avoid disturbance to active nests, eggs, and/or young of nesting birds. Surveys can be used to detect the nests of special-status as well as non-special-status birds. Surveys will encompass the entire construction area and the surrounding 500 feet. An exclusion zone where no construction would be allowed will be established around any active nests of any protected avian species found in the Project Area until a qualified biologist has determined that all young have fledged and are independent of the nest. Suggested exclusion zone distances differ depending on species, location, and placement of nest, and will be at the discretion of the biologist and, if necessary, the CDFW. These surveys would remain valid as long as construction activity is consistently occurring in a given area and will be completed again if there is a lapse in construction activities of more than 14 consecutive days during the breeding bird season. ROOSTING BATS Special-status and non-status bat species have the potential to be present in redwood or oak trees throughout the Project Area. Project construction activities have the potential to affect nests in these areas if construction is initiated during the bat maternity season (generally April Page 438 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 12 through October). Potential effects include direct destruction of roosts as well as indirect visual and acoustic disturbance to roosting bats from construction in adjacent areas. Destruction of roosts or indirect disturbance from construction that results in roost abandonment are considered potentially significant effects under CEQA. Based on extensive development within and adjacent to the Study Area, the area of lost potential roosting habitat is considered a less than significant effect. Potential Affect BIO-3: Project construction activities have the potential directly or indirectly disturb special-status and non-status roosting bats. Construction could directly destroy active roosts or cause disturbance that results in roost abandonment. To reduce potential effects of roosting bats to a less-than-significant level, the following measures shall be implemented: Avoidance Measure BIO-3: Initiation of construction activities during the bat maternity season (generally April through October) will be avoided to the extent feasible, any tree removal or trimming should be conducted outside of the bat maternity season (generally April through October). If this work window is not feasible, pre- construction bat roost assessments conducted by a qualified biologist at least 14 days and no more than 30 days prior to removal are recommended to determine if bats roosts are present that may be affected by Project activities. If special- status bat species or maternity roosts are detected during these surveys, additional measures including avoidance of the roost sites until the end of the maternity roosting season may be recommended. 8.1.2 Sensitive Natural Communities Affects and Avoidance Evaluation This section addresses the question outlined in CEQA Appendix G, Part IV (b): b) Does the Project have a substantial adverse effect on any riparian habitat or other sensitive natural community identified in local or regional plans, policies, regulations, or by the California Department of Fish and Game or U.S. Fish and Wildlife Service. While there is sensitive habitat mapped within the Study Area, such as potential seasonal wetland swale, intermittent stream, oak woodland and riparian woodland, there is no sensitive habitat within the proposed Project footprint and Project activities will be well isolated from sensitive areas. The Project will not adversely affect sensitive natural communities. 8.1.3 Affects and Avoidance Evaluation for Wetlands and Other Areas Regulated by Section 404 of the Clean Water Act This section analyzes the Project’s potential to affect and minimization for wetlands and other areas presumed or determined to be within the jurisdiction of the Corps. in reference to the significance threshold outlined in CEQA Appendix G, Part IV (c): c) Does the Project have the potential to have a substantial adverse effect on state or federally protected wetlands as defined by Section 404 of the Clean Water Act (including, Page 439 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 13 but not limited to, marsh, vernal pool, coastal, etc.) through direct removal, filling, hydrological interruption, or other means; While there is a potential seasonal wetland swale and an intermittent stream within the Study Area, there are no wetlands and waters within the Project footprint. The Project will not adversely affect jurisdictional wetlands. 8.1.4 Affects and Minimization Evaluation for Habitat Corridors and Linkages This section analyzes the Project’s potential to affect and minimization for habitat corridors and linkages in reference to the significance threshold outlined in CEQA Appendix G, Part IV (d): d) Does the Project have the potential to interfere substantially with the movement of any native resident or migratory fish or wildlife species or with established native resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites; Movement and migratory corridors are segments of land that provide a link between core habitat areas (Beier 1992, Soule and Terborgh 1999). The majority of the Study Area is developed or previously disturbed and is within a densely developed urban area. The site does not contain sufficient natural features to function as a wildlife movement corridor. The Project will not adversely effect movement or migratory corridors resulting from the Project because no movement or migratory corridors are present on the site. 8.1.5 Affects and Minimization Evaluation for Local Policies and Ordinances This section analyzes the Project’s potential to affect conflicts with local policies and ordinances in reference to the significance threshold outlined in CEQA Appendix G, Part IV (e): e) Does the Project have the potential to conflict with any local policies or ordinances protecting biological resources, such as a tree preservation policy or ordinance; The Project may affect trees protected by the Town of Los Gatos’s Tree Removal and Pruning Permit. A tree removal permit will be obtained from the City of Los Gatos prior to the removal of such trees, in compliance with the City codes.A tree re-planting plan will be implemented as a condition of the permit to replace all removals at a 1:1 with native oak trees or other regionally appropriate species. Tree removal and re-planting plans including data on all trees on site are provided in Attachment A. The Project will not adversely affect or conflict with local codes and ordinances protecting biological resources. 8.1.6 Habitat Conservation Plans This section analyzes the Project’s potential effects and minimization based on conflicts with any adopted local, regional, and state habitat conservation plans in reference to the significance threshold outlined in CEQA Appendix G, Part IV (f): Page 440 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 14 f) Does the Project have the potential to conflict with the provisions of an adopted Habitat Conservation Plan, Natural Community Conservation Plan, or other approved local, regional, or state habitat conservation plan. The Study Area is mapped outside of the Habitat Plan Study Area in the Santa Clara County Habitat Plan. Additionally, the Study Area is surrounded by fully developed residential uses and would not affect special-status species habitat or other sensitive habitats or involve a change in use type of the existing land cover. Therefore, the Project would not adversely affect or conflict with the Santa Clara County Habitat Plan. Page 441 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 15 REFERENCES Beier, P and S. Loe. 1992. A checklist for evaluating affects to wildlife movement corridors. Wildlife Society Bulletin. 20: 434-440. [CCH2] Consortium of California Herbaria 2. 2025. CCH2 Portal. Online at: http://cch2.org/portal/index.php; most recently accessed: February 2025. [CDFW] California Department of Fish and Wildlife. 2022. California Natural Community List. Biogeographic Data Branch. Vegetation Classification and Mapping Program, Sacramento, California. July 5. [CDFW] California Department of Fish and Wildlife. 2025. California Natural Diversity Database. Biogeographic Data Branch, Vegetation Classification and Mapping Program, Sacramento, California. Available online at: https://wildlife.ca.gov/Data/CNDDB/Maps- and-Data; most recently accessed: February 2025. [CNPS] California Native Plant Society. 2025a. Inventory of Rare and Endangered Plants (online edition, v8-03 0.39). Sacramento, California. Online at: http://rareplants.cnps.org/; most recently accessed: February 2025. [CNPS] California Native Plant Society. 2025b. A Manual of California Vegetation, Online Edition. Sacramento, California. Online at: http://vegetation.cnps.org/; most recently accessed: February 2025. [CSRL] California Soil Resource Lab. 2025. SoilWeb. Online at: http://casoilresource.lawr.ucdavis.edu/; most recently accessed: February 2025. eBird. 2025. eBird: an online database of bird distribution and abundance [web application]. eBird, Cornell Lab of Ornithology, Ithaca, New York. Available: http://www.ebird.org; most recently accessed: April 2025. Google Earth. 2025. Aerial Imagery 1948-2025. Most recently accessed: February 2025. Kelly, P. A. 1990. Population ecology and social organization of dusky-footed woodrats, Neotoma fuscipes . Ph.D. dissertation, Univ. of California, Berkeley, 191 pp. [NETR] Nationwide Environmental Title Research. 2025. Historic Aerials. Available online at: http://www.historicaerials.com/; most recently accessed: February 2025. Soulé, M.E. and J. Terbough. 1999. Conserving nature at regional and continental scales - a scientific program for North America. Bioscience 49:809-817. Stebbins, RC. 2003. Western Reptiles and Amphibians. Third Edition. Houghton Mifflin Harcourt. March 27. Page 442 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 16 Shuford, W.D., and T. Gardali (eds). 2008. California Bird Species of Special Concern: A ranked assessment of species, subspecies, and distinct populations of birds of immediate conservation concern in California. Studies of Western Birds 1. Western Field Ornithologists, Camarillo, California, and CDFG, Sacramento. Thomson, R.C., A.N. Wright, and H.B. Shaffer. 2016. California Amphibian and Reptile Species of Special Concern. Co-published by the California Department of Fish and Wildlife and University of California Press. Oakland, California. [USGS] United States Geological Survey. 2021. San Jose West 7.5-minute Quadrangle map. [USFWS] U.S. Fish and Wildlife Service. 2025a. National Wetlands Inventory website. U.S. Department of the Interior, Washington, D.C. Online at: http://www.fws.gov/wetlands/; most recently accessed: February 2025. [USFWS] United States Fish and Wildlife Service. 2025b. Information for Planning and Conservation Database. Available online at: https://ecos.fws.gov/ipac/; most recently accessed: February 2025. Page 443 DOOH (O 3 D G U H :HGJHZRRG$YH:HGJHZRRG$YH*U DQ DGD : D\/D 5LQFRQDGD&RXQWU\ &OXE/D 5LQFRQDGD7HQQLV &RXUWV6PLWK &UHHN .D UO $ Y H %LFNQHOO5G6PLWK&UHHN.DUO $Y H 6PLWK&UHHN ' U (DWRQ/Q9DOOH\ )Z\H\)Z\:HGJHZRRG $YH&OHDUYLHZ'U/D 5LQFRQDGD'U0XOEHUU\ 'U (DVWYLHZ 'U :9DOOH\)Z\&O DUD 6W*ROI /LQNV'U/D 5LQ FRQDGD 'U (DVWYLHZ 'U &ODUD 6W=HQD $YH(DWRQ/Q1DWDO\H 5G *URVYHQRU&W:LQFKHVWHU%OYG:1HZHOO $YH:, 0!, "/0,9$,$9/9,9300009La Rinconada Country ClubLos Gatos, California30",9/,)LJXUH%LRORJLFDO5HVRXUFHVmPage 444 WRA, Inc.| 2169 G East Francisco Blvd., San Rafael, CA 94901 www.wra-ca.com · ph: 415.454.8868 18 ATTACHMENT A. PROJECT PLANS Page 445 PROJECT DATAPLANNER/CIVIL ENGINEER:HMH ENGINEERSCONTACT: STEPHAN KUEHN1570 OAKLAND ROADSAN JOSE, CA 95131(669)295-2357DEVELOPMENT TEAMCOMFORT STATION ARCHITECT:E2 ARCHITECTSCONTACT: JEFFREY EATON307 ORCHARD CITY DRIVE, STE 350CAMPBELL, CA 96008(408)691-8998GOLF COURSE ARCHITECT:ORIGINS GOLF DESIGNCONTACT: TODD ECKENRODE18022 COWAN, STE 230IRVINE, CA 92614(949)476-6878LA RINCON A D A D R SITELA RINCON A D A D R SITEARCHITECTURAL AND SITE REVIEWLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECTTITLE SHEETOBNOT TO SCALEOBTABLE OF CONTENTSPLANNING/CIVIL ENGINEERINGG1.0 TITLE SHEETG2.0 SITE CONTEXT PHOTOGRAPHSG2.1 PRESENT DAY AERIALG3.0 EXISTING CONDITIONS PLANG3.1 EXISTING CONDITIONS PLANG3.2 EXISTING ENTRY ROAD CONDITIONSC-0.0 COVER SHEETC-1.0 CIVIL DRAINAGE & UTILITY PLANC-1.1 CIVIL DRAINAGE & UTILITY PLANC-1.2 CIVIL DRAINAGE & UTILITY PLANC-1.3 CIVIL DRAINAGE & UTILITY PLANC-1.4 CIVIL DRAINAGE & UTILITY PLANC-1.5 CIVIL DRAINAGE & UTILITY PLANC-3.0 CIVIL DETAILSC-3.1 CIVIL DETAILSC-4.0 PRELIMINARY ENTRY ROAD GRADING & DRAINAGE PLANC-4.1 PRELIMINARY STORMWATER CONTROL PLANC-5.0 INTERIM EROSION CONTROL PLANC-5.1 INTERIM EROSION CONTROL PLANC-5.2 INTERIM EROSION CONTROL MEASURESC-6.0 FIRE ACCESS PLANARCHITECTUREAO-1 OVERALL PLANAO-2 DEMOLITION PLANAO-3 DEMOLITION PLANAO-4 GRADING PLANAO-5 GRADING PLANAO-6 FEATURES PLANAO-7 FEATURES PLANGOVERNMENT AGENCIES:TOWN OF LOS GATOSCONTACT: RYAN SAFTY110 E. MAIN STLOS GATOS, CA 95030(408)354-6802OWNER:CLEARVIEW GOLF ASSOCIATES LLCCONTACT: ANDY KIMBALL14595 CLEARVIEW DRIVELOS GATOS, CA 95032(408)402-7468ASSESSOR'S PARCEL NUMBER:PROJECT ADDRESS/LOCATION:EXISTING GENERAL PLAN DESIGNATION:EXISTING ZONING DESIGNATION:PROPOSED USE:GROSS SITE AREA:RIGHT-OF-WAY DEDICATION:NET SITE AREA:CONSTRUCTION SCHEDULE:START DATE:COMPLETION DATE:409-31-001, 409-18-008, -009, -01017400 WEDGEWOOD AVE AND 17445 ZENA AVE LOS GATOS, CAOPEN SPACERC- RESOURCE CONSERVATION, R-1:20 SINGLE FAMILY RESIDENTIALGOLF COURSE±118.35 AC±000.00 AC±118.35 AC3/16/20269/28/2026PROJECT DESCRIPTIONDEVELOPER:LA RINCONADA COUNTRY CLUBCONTACT: ANDY KIMBALL14595 CLEARVIEW DRIVELOS GATOS, CA 95032(408)402-7468ARCHITECTURAL AND SITE REVIEW FOR GOLF COURSE RENOVATIONS AND UPGRADES TO THE EXISTING GOLF COURSE INCLUDING A NEW CONNECTING CART PATH,NEW TEE, FAIRWAY, GREEN, AND BUNKER AREAS, TURF REPLACEMENT TO INCREASE DROUGHT TOLERANCE, A REALIGNED ENTRY ROAD, AND UPDATES TO THEEXISTING COMFORT STATION. PROJECT INCLUDES TREE REMOVAL AND REPLACEMENT. AO-8 GRASSING PLANAO-9 GRASSING PLANAO-10 EARTHWORKS EXHIBITAO-11 CART PATH PLANAO-12 CONSTRUCTION DETAILSAO-13 CONSTRUCTION DETAILSA0.0 GENERAL INFORMATION (COMFORT STATION)A0.3 BLUEPRINT FOR A CLEAN BAYA1.0 OVERALL AND ENLARGED PROPOSEDSITE PLANA2.3 PROPOSED FLOOR PLANA2.4 PROPOSED DIMENSIONED FLOOR PLAN& WALL TYPESA2.6 PROPOSED ROOF PLANA3.1 PROPOSED EXTERIOR ELEVATIONSA3.2 BUILDING SECTIONSA4.1 PROPOSED FF&E FLOOR PLAN & ELEVATIONSA6.1 PROPOSED REFLECTED CEILING PLANLANDSCAPECOVER COVER SHEETTD-1 TREE DISPOSITION PLANTD-2 TREE DISPOSITION PLANTD-3 TREE DISPOSITION PLANTD-4 TREE DISPOSITION PLANTD-5 TREE DISPOSITION PLANTD-6 TREE DISPOSITION PLANTI-1 TREE INVENTORYTI-2 TREE INVENTORYT1-3 TREE INVENTORYT1-4 TREE INVENTORYIP-1 IRRIGATION PLANIP-2 IRRIGATION PLANIP-3 IRRIGATION PLANIP-4 IRRIGATION PLANIP-5 IRRIGATION PLANIP-6 IRRIGATION DETAILSPP-1 PLANTING PLANPP-2 PLANTING PLANPP-3 PLANTING PLANPP-4 PLANTING PLANPP-5 PLANTING PLANPD-1 PLANTING DETAILSPD-2 PLANTING TYPICALSLK0.1 LAKE SYSTEM SITE PLAN, NOTES, ETCLK1.1 LAKE SYSTEM PLAN VIEWLK1.2 LAKE SYSTEM PLAN VIEWLK1.3 LAKE SYSTEM PLAN VIEWLK1.4 LAKE SYSTEM PLAN VIEWLK1.5 LAKE SYSTEM PLAN VIEWLK2.1 LAKE SYSTEM CROSS SECTIONSLK3.1 LAKE SYSTEM DETAILSLK3.2 LAKE SYSTEM DETAILSLK3.3 LAKE SYSTEM DETAILSLK3.4 LAKE SYSTEM DETAILSLK3.5 LAKE SYSTEM DETAILSLK3.6 LAKE SYSTEM DETAILSLK4.1 LAKE AERATION SYSTEM DETAILSLK4.2 LAKE AERATION SYSTEM DETAILSLK5.1 LAKE TRANSFER PUMP STATIONLK6.1 LAKE SYSTEM MECHANICAL DETAILSDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504TS.DWG454504TS.DWGG1.04545.04JANUARY 17, 202580PLOTTED: 4/4/2025 2:03 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSWEDGEWOOD AVEWEDGEWOOD AVEHWY 85HWY 85CLEARVIEW DRCLEARVIEW DRWIMBLE D O N D R WIMBLE D O N D R WINCHESTER BLVDWINCHESTER BLVDGRANADA W A Y GRANADA W A Y LANDSCAPE ARCHITECT:PINNACLE DESIGNCONTACT: KEN ALPERSTEIN77935 CALLE TAMPICO, STE 220LA QUINTA, CA 92253(760)636-2558CIVIL ENGINEER: CLIFF BECHTEL AND ASSOCIATES, LLCCONTACT: CLIFF BECHTEL1321 254TH PLACE, SESAMMAMISH, WA 98075(650)333-0103OBPage 446 SITE CONTEXTPHOTOGRAPHSNOT TO SCALEDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504SITE_PHOTOS.DWG454504SITE_PHOTOS.DWGG2.04545.04JANUARY 17, 202547PLOTTED: 3/26/2025 2:55 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTS80Page 447 PRESENT DAYAERIALNOT TO SCALEDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504PRESENT DAY AERIAL.DWG454504PRESENT DAY AERIAL.DWGG2.14545.04JANUARY 17, 202547PLOTTED: 3/18/2025 9:41 AMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/14/2025 PER TOWN COMMENTS80Page 448 AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT60' SCVWD EASEMENT10' SEWER EASEMENT40.26' PUBLIC STREET EASEMENTAREA NOT PARTOF PROJECTSITELA RINCONADA DRWEDGEWOOD DREXISTINGCONDITIONS PLANOBAS SHOWNOBVICINITY MAPSCALE: 1" = 1000'DRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EX.DWG454504EX.DWGG3.04545.04JANUARY 17, 202580PLOTTED: 4/9/2025 1:24 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSSK1 INCH = 150 FEET0 75 150 300LINETYPE LEGENDEXISTING PROPERTY LINEPROJECT BOUNDARYCENTERLINECONTOURSEXISTING EASEMENTEXISTING TOPOGRAPHYPage 449 OF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT10' SEWER EASEMENT40' ROAD EASEMENTEXISTINGCONDITIONS PLANOBAS SHOWNOBDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EX.DWG454504EX.DWGG3.14545.04JANUARY 17, 202580PLOTTED: 4/9/2025 1:27 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSSK1 INCH = 150 FEET0 75 150 300LINETYPE LEGENDEXISTING PROPERTY LINEPROJECT BOUNDARYCENTERLINECONTOURSEXISTING EASEMENTEXISTING TOPOGRAPHYPage 450 SITELA RINCONADA DRWEDGEWOOD DRAC 351.66AC 351.64AC 351.15AC 350.90AC 350.14AC 349.64AC 348.36AC 349.69AC 348.57AC 347.80AC 346.96AC 346.79AC 347.19AC 350.62AC 349.46AC 351.88AC 352.84AC 353.03AC 354.94AC 354.931.1%1.8%1.1%3.0%2.7%AC 346.43 ~ LP19.3'± E X R O A D 26.2'± EX ROAD23.4'± EX ROAD1.0%2.2%3.8%2.2%1.7%8.0%9.5% 3.2% 3.4% 4.6%0.5%EX 8" VCP ~ 191'EX 8" VCP ~ 258'EX 8" VCP ~ 438'EX SSMHRIM 348.5±EX 8" INV 338.4±EX SSMHRIM 357.6±EX 8" INV 348.6±EX SSMHRIM 350.3±EX 8" INV 336.3±EX GREASE INTERCEPTOREX 8" VCP ~ 137'20'± EXENTRY GATE EX LIGHT POLE, TYP.EX 12" SDEX OUTFALL.10' PS S E RVIEW DRIVEBLIC STREET)WATERVALVEBOXWATERVALVEVAULTCOMMBOXELECBOXELECBOX ELECBOX ELECBOXELEC BOXAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF P R O J E C T AREA NOT PARTOF PROJECT60' S C V W D E A S E M E N T 10' SEWER EASEMENT40.26' PUBLIC STREET EASEMENT40' RO A D E A S E M E N T AREA NOT PARTOF PROJECTEXISTING ENTRYROAD CONDITIONSOBAS SHOWNOBVICINITY MAPSCALE: 1" = 1000'DRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EX.DWG454504EX.DWGG3.24545.04JANUARY 17, 202580PLOTTED: 4/9/2025 2:13 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSSK1 INCH = 20 FEET4020100ABBREVIATIONSLEGENDPROPERTY LINEPROJECT BOUNDARYEX FACE OF CURBEX AC SPOT GRADESAC XX.XXAC ASPHALT CONCRETEEX/(E) EXISTINGLP LOW POINTPSSE PUBLIC SANITARY SEWER EASEMENTSD STORM DRAINSDFI STORM DRAIN FIELD INLETSS SANITARY SEWERSSMH SANITARY SEWER MANHOLESSCO SANITARY SEWER CLEANOUTX%X%EX PERCENT & DIRECTIONOF SURFACE FLOWDRAINAGEEX SSMHEX SSCOEX SANITARY SEWER PIPEEX SS PIPE SLOPEEX STORM DRAIN PIPEDIA" MATERIAL ~ LENGTH'EX SDFIEX ELECTROLIER1EX FIRE HYDRANTEX BACKFLOW PREVENTERKEYMAPSCALE: 1" = 1000'ENTRY ROADAREA OF WORKPage 451 Page 452 Page 453 Page 454 Page 455 Page 456 Page 457 Page 458 Page 459 Page 460 SDSD11.9%5.5%2.0%2.0%6.3%12.4%3.0%2.9%3.6%SDFIRIM 346.912" INV 342.4 OUTCONFORM TOEX AC 356.8±CONFORM TOEX AC 356.0±CONFORM TOEX AC 352.3±EX 10' P U B LI C SANIT A R Y S E W E R EASE M E N T EX PORTION OF ENTRYROAD TO BE REMOVEDEX PLCONFORM TOEX AC 352.0±TC 347.3FL 346.8TC 347.0~LPFL 346.5TC 350.5~GBFL 350.0TC 350.1~GBFL 349.7TC 350.1~GBFL 349.6BIORETENTION AREATOP OF SLOPE = 347.0TOP OF SOIL = 346.4LIMIT OF WORKPROJECT BOUNDARYTC 350.5~GBFL 350.022' NEWENTRY ROADSD OUTFALL12" INV 341.7EX ENTRY ROADAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT60' SCVWD EASEMENT10' SE W E R E A S E M E N T40.26' PUBLIC STREET EASEMENT40' ROAD EASEMENTAREA NOT PARTOF PROJECTPRELIMINARYENTRY ROADGRADING &DRAINAGE PLANCM/TUAS SHOWNCM/TUDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504GP.DWG454504GP.DWGC4.04545.04JANUARY 17, 202547PLOTTED: 3/26/2025 3:04 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTS1 INCH = 20 FEET40201001. GRADES, INVERTS, AND UTILITY LOCATIONS SHOWN ON THIS PLAN ARECONCEPTUAL ONLY AND ARE NOT TO BE USED FOR CONSTRUCTION.NOTESABBREVIATIONSLEGENDPROPOSED EXISTINGPROPERTY LINESTORM DRAIN PIPESDPROJECT BOUNDARYEASEMENTGRADE BREAKSPOT GRADESFG XX.XXEG XX.XXAC ASPHALT CONCRETEEX/(E) EXISTINGEG EXISTING GRADEFG FINISH GRADEFL FLOW LINEFS FINISH SURFACEGB GRADE BREAKHP HIGH POINTINV INVERTLP LOW POINTPL PROPERTY LINESD STORM DRAINSDFI STORM DRAIN FIELD INLETTC TOP OF CURBSTORM DRAIN FIELD INLETX%X%PERCENT & DIRECTION OFSURFACE FLOW DRAINAGEBIORETENTION BASINSTORM DRAIN PERFORATED PIPEOUTFALLSDKEYMAPSCALE: 1" = 1000'ENTRY ROADAREA OF WORK2:1 MAX SLOPEAC PAVEMENT11RESPONSIBILITY TO INDEPENDENTLY ESTIMATEAPPROXIMATE. IT SHALL BE THE CONTRACTOR'SNOTE: EARTHWORK QUANTITIES SHOWN AREEARTHWORK QUANTITIESFILL:CUT:EXPORT:IMPORT:QUANTITIES FOR HIS/HER OWN USE.480 CY0 CY480 CY0 CY1180Page 461 111810171615141312126543789AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT60' SCVWD EASEMENT10' SEWER EASEMENT40.26' PUBLIC STREET EASEMENT40' ROAD EASEMENTAREA NOT PARTOF PROJECTDMA1DMA2TCM 2BIORETENTION AREA616 SF REQUIRED621 SF PROVIDEDPAVEMENTSLOPE TODRAIN18" MIN.6" HIGHCURB6" HIGHCURBSECTION VIEW6"AAA-ASEEBIORETENTIONORFTP DETAILSCURB OPENING2N.T.S.WARPEDGUTTERCLPLAN VIEW3'-6"12"AA1'-6" MIN6"VARIESSEEPLAN0.2'MIN.6"6"X"3MAXPLACE 4" MIN. DIA. APPROVEDCOBBLE 0.2' BELOW CURBOPENINGS FOR DISTANCE OF 2'EITHER SIDE OF CURB OPENINGSDEPRESS 2"AT OPENING24"24"112" MIN. OF CLASS II PERMEABLE ROCKPER CALTRANS SPECS. ROCK SECTION TO INCREASE WITH SLOPE OF PIPE.VARIESVARIESPERFORATED PIPE(SLOPE AT 0.50% MIN)W/ PERFORATIONS DOWN.SEE PLAN FOR LENGTHAND LOCATION.3:1 MAX18"CLEANOUTW/ CAP ATFINISH GRADEVARIES-SEE PLANVARIES-SEE PLANPLACE 4" MIN. DIA. APPROVED COBBLE 0.2' BELOW CURB OPENINGS FORDISTANCE OF 2' EITHER SIDE OF CURBOPENINGS.PLACE GEOTEXTILE BETWEEN COBBLES & NATIVE SOIL FOR EROSION CONTROL.SOLID OVERFLOW PIPEBIORETENTION BASIN W/ LINERIMPERMEABLE LINERN.T.S.CHRISTY V12OR APPROVED EQUALOVERFLOW RISERW/ GRATEBIO-TREATMENTSOIL MIX (BSM)PER SPECS.RISER HEIGHT SEE TCMSUMMARY TABLE0.2"8"MIN.PRELIMINARYSTORMWATERCONTROL PLANCM/TUAS SHOWNCM/TUDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504SW.DWG454504SW.DWGC4.14545.04JANUARY 17, 202580PLOTTED: 4/9/2025 2:21 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTS1 INCH = 20 FEET4020100DMA#LID TREATMENT DRAINAGE AREASTORM DRAIN PIPESDSDSDCATCH BASINSTORM DRAIN MANHOLECATCH BASIN (EXISTING)CURB INLET (EXISTING)STORM DRAIN MANHOLE (EXISTING)PROJECT BOUNDARYLEGENDBIORETENTION AREAPROJECT SITE INFORMATION:1. SOILS TYPE: CLAY LOAM2. GROUND WATER DEPTH: 30 TO 50 FT3. NAME OF RECEIVING BODY: SAN TOMAS AQUINO CREEK4. FLOOD ZONE: ZONE X5. FLOOD ELEVATION (IF APPLICABLE): N/AOPERATION AND MAINTENANCEINFORMATION:I. PROPERTY INFORMATION:I.A. PROPERTY ADDRESS:14595 Clearview DriveLos Gatos, CA 95032APN:409-31-001409-18-008, -009, -010I.B. PROPERTY OWNER:La Rinconada Country ClubII. RESPONSIBLE PARTY FOR MAINTENANCE:II.A. CONTACT: La Rinconada Country ClubII.B. PHONE NUMBER OF CONTACT:(408) 402-7468 II.C. EMAIL:akimball@Larinconadacc.comII.D. ADDRESS:14595 Clearview DriveLos Gatos, CA 950321. DISPOSITION AND TREATMENT OF STORM WATER WILL COMPLY WITH THENATIONAL POLLUTION DISCHARGE ELIMINATION SYSTEM STANDARDS ANDIMPLEMENTATION STANDARDS ESTABLISHED BY THE SANTA CLARAVALLEY URBAN RUNOFF POLLUTION PREVENTION PROGRAM.NOTESSOURCE CONTROL MEASURES:1. BENEFICIAL LANDSCAPING.2. MAINTENANCE (PAVEMENT SWEEPING, CATCH BASIN CLEANING,GOOD HOUSEKEEPING).3. STORM DRAIN LABELING.SITE DESIGN MEASURES:1. MINIMIZE LAND DISTURBED2. MINIMIZE IMPERVIOUS SURFACES3. CLUSTER STRUCTURES / PAVEMENT4. SELF-RETAINING AREA1. SEE GRADING PLAN FOR BASIN FOOTPRINT AND DESIGNELEVATIONS.2. PLACE 3 INCHES OF COMPOSTED, NON-FLOATABLE MULCH INAREAS BETWEEN STORMWATER PLANTINGS AND SIDE SLOPE.3. SEE LANDSCAPE PLAN FOR MULCH, PLANT MATERIALS ANDIRRIGATION REQUIREMENTS4. CURB CUTS SHALL BE A MINIMUM 18" WIDE AND SPACED ATMAXIMUM 10' O.C. INTERVALS AND SLOPED TO DIRECTSTORMWATER TO DRAIN INTO THE BASIN. CURB CUTS SHALLALSO NOT BE PLACED INLINE WITH OVERFLOW CATCH BASIN.SEE GRADING PLAN FOR MORE DETAIL ON LOCATIONS OFCURB CUTS.5. A MINIMUM 0.2' DROP BETWEEN STORM WATER ENTRY POINT(I.E. CURB OPENING, FLUSH CURB, ETC.) AND ADJACENTLANDSCAPE FINISHED GRADE.6. DO NOT COMPACT NATIVE SOIL / SUBGRADE AT BOTTOM OFBASIN. LOOSEN SOIL TO 12" DEPTH.AS THE GOLF COURSE IS MOSTLY PERVIOUS, PROPOSED CART PATHS WILLDRAIN TO LANDSCAPE AREAS AND BE CONSIDERED "SELF-RETAINING" AREAS.THE PROPOSED DRIVEWAY RECONFIGURATION WILL BE TREATED BY ABIORETENTION PLANTER THAT IS SIZED TO TREAT NEW AND EXISTINGPORTIONS OF THE ENTRY ROAD.STORMWATER TREATMENT SUMMARY11Page 462 275280285290295300305310315320325330335340345350355360365370375380375380385280285290295300305310315320325285290295300305310315320325330335340345350355350350355360365370375380350350350355360365370370365375380380380380330325330335340345350355360365370280285280290295300305310315320285290295300305310285290295300305310315320325330335280280275275280380375370365360 355 350350345335325340345350355 345340335696727027027528029529530033003333535353333333333330505300552267769693535338038038003838080000031311101000155315315315315355511810126543789AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT60' SCVWD EASEMENT10' SEWER EASEMENT40.26' PUBLIC STREET EASEMENTAREA NOT PARTOF PROJECTSTABILIZED CONSTRUCTIONENTRANCETC-1C5.2FIBER ROLLS (TYP.)STORM DRAIN INLETPROTECTIONSE-1C5.2FIBER ROLLS (TYP.)SE-5C5.2SE-5C5.2CLEARVIEW DRIVECLEARVIEW DRIVELA RINCONADA DRIVEWEDGEWOOD AVEGRANADA W A Y APPROXIMATECONSTRUCTIONSTAGING AREASDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EC.DWG454504EC.DWGC5.04545.04JANUARY 17, 202580PLOTTED: 3/31/2025 9:06 AMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSINTERIMEROSIONCONTROLMEASURESTUAS SHOWNTU1 INCH = 150 FEET0 75 150 300GENERAL EROSION AND SEDIMENT CONTROL NOTES1. CONTRACTOR/OWNER:CLIFF BECHTEL AND ASSOCIATES, LLCADDRESS: 1321 254TH PLACE, SESAMMAMISH, WA 98075ATTN: CLIFF BECHTEL(650) 333-0103IT SHALL BE THE OWNER'S RESPONSIBILITY TO MAINTAIN CONTROL OF THE ENTIRE CONSTRUCTION OPERATION AND TO KEEP THEENTIRE SITE IN COMPLIANCE WITH THE SOIL EROSION CONTROL PLAN.2. CIVIL ENGINEER:HMH ENGINEERS1570 OAKLAND ROAD, SUITE 200SAN JOSE, CA 95131ATTN: STEPHAN KUEHN(408) 487-22003. THIS PLAN IS INTENDED TO BE USED FOR INTERIM EROSION AND SEDIMENT CONTROL ONLY AND IS NOT TO BE USED FOR FINALELEVATIONS OR PERMANENT IMPROVEMENTS.4. DEVELOPER WILL SUBMIT TO THE CITY MONTHLY (AT THE FIRST OF EACH MONTH BETWEEN OCT 1ST AND APRIL 30TH)CERTIFICATIONS THAT ALL EROSION/SEDIMENT MEASURES IDENTIFIED ON THE APPROVED EROSION CONTROL PLAN ARE IN PLACE.IF MEASURES ARE NOT IN PLACE, DEVELOPER SHALL PROVIDE THE CITY WITH A WRITTEN EXPLANATION OF WHY THE MEASURE ISNOT IN PLACE AND WHAT WILL BE DONE TO REMEDY THIS SITUATION.5. OWNER/CONTRACTOR SHALL BE RESPONSIBLE FOR MONITORING EROSION AND SEDIMENT CONTROL MEASURES PRIOR, DURING,AND AFTER STORM EVENTS.6. REASONABLE CARE SHALL BE TAKEN WHEN HAULING ANY EARTH, SAND, GRAVEL, STONE, DEBRIS, PAPER OR ANY OTHERSUBSTANCE OVER ANY PUBLIC STREET, ALLEY OR OTHER PUBLIC PLACE. SHOULD ANY BLOW, SPILL, OR TRACK OVER AND UPONSAID PUBLIC OR ADJACENT PRIVATE PROPERTY, IMMEDIATE REMEDY SHALL OCCUR.7. SANITARY FACILITIES SHALL BE MAINTAINED ON THE SITE.8. DURING THE RAINY SEASON, ALL PAVED AREAS SHALL BE KEPT CLEAR OF EARTH MATERIAL AND DEBRIS. THE SITE SHALL BEMAINTAINED SO AS TO MINIMIZE SEDIMENT LADEN RUNOFF TO ANY STORM DRAINAGE SYSTEM, INCLUDING EXISTING DRAINAGESWALES AND WATER COURSES.11. CONSTRUCTION OPERATIONS SHALL BE CARRIED OUT IN SUCH A MANNER THAT EROSION AND WATER POLLUTION WILL BEMINIMIZED. STATE AND LOCAL LAWS CONCERNING POLLUTION ABATEMENT SHALL BE COMPLIED WITH.12. CONTRACTOR SHALL PROVIDE DUST CONTROL AS REQUIRED BY THE APPROPRIATE FEDERAL, STATE AND LOCAL AGENCYREQUIREMENTS.LEGENDFIELD INLET SEDIMENT BARRIERFIBER ROLLSTABILIZED CONSTRUCTION ENTRANCESEE SHEET C5.1EXISTING CONTOUR TO REMAINPROPOSED CONTOUR111111111Page 463 365370375380375380385345350355350350355360365370375380350350350355360365370370365375375375375380380380380380380375375375370370 365365 355360380380380385385385390390390395395395400400400400400395395395395370370370370365365365365360360360360355355355350345330350355360365370305310380375370365360 355 350350345350355 3453403353606967 3903903393000040000400000333955953959595995955553995959567785585855855696933338038038003803800000037757775775537737333311181017161514131289OF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT10' SEWER EASEMENT40' ROAD EASEMENTFIBER ROLLS (TYP.)SE-5C5.2LA RINCONADA DRIVEZENA WAYLA RINCON A D A D R I V E DRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EC.DWG454504EC.DWGC5.14545.04JANUARY 17, 202547PLOTTED: 3/26/2025 3:06 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSINTERIMEROSIONCONTROLMEASURESTUAS SHOWNTU1 INCH = 150 FEET0 75 150 300LEGENDFIELD INLET SEDIMENT BARRIERFIBER ROLLSTABILIZED CONSTRUCTION ENTRANCESEE SHEET C5.0EXISTING CONTOUR TO REMAINPROPOSED CONTOUR180Page 464 DRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EC.DWG454504EC.DWGC5.24545.04JANUARY 17, 202547PLOTTED: 3/26/2025 3:06 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTSINTERIMEROSIONCONTROLMEASURESTUAS SHOWNTUN.T.S.ENCROACHMENT DETAILN.T.S.FIBER ROLL INSTALLATION3/4" x 3/4" WOOD STAKES MAX4" SPACING4" MAX12" MIN2" MINFIBER ROLL 8" MIN4' MAX4' MAX4' MAX4' MAXVERTICAL SPACING MEASURED ALONGTHE FACE OF THE SLOPE VARIESBETWEEN 10' AND 20'NOTE:INSTALL FIBER ROLL ALONG A LEVELCONTOURFIBER ROLLSINSTALL FIBER ROLL NEAR SLOPEWHERE IT TRANSITIONS INTO ASTEEPER SLOPENOTE:SIZE SPILLWAY TO CONVEY PEAKDESIGN FLOWTYPICAL OPEN SPILLWAYEARTH EMBANKMENTOUTLET PROTECTIONEXCAVATE IF NECESSARY FORSTORAGEOUTLET PIPE OR USE ALTERNATIVEOPEN SPILLWAYFLOWWATERTIGHT CONNECTIONPERFORATE RISERALL SLOPE 1:3 (V:H)OR FLATTER12" MIN5'-0" MINTYPICAL SLOPE SOIL STABILIZATIONN.T.S.SE-5 FIBER ROLLSN.T.S.SE-3 SEDIMENT TRAP-12" MIN. UNLESSOTHERWISE SPECIFIEDBY SOILS ENGINEERCORRUGATED STEEL PANELSFILTER FABRICORIGINAL GRADECRUSHED AGGREGATE GREATER THAT 3" BUTSMALLER THAN 6"SECTION A-AFILTER FABRICORIGINAL GRADECRUSHED AGGREGATE GREATER THAT 3" BUTSMALLER THAN 6"-12" MIN. UNLESSOTHERWISE SPECIFIEDBY SOILS ENGINEERSECTION B-BN.T.S.N.T.S.NOTE:MANY DESIGNS CAN BE FIELD FABRICATED, ORFABRICATED UNITS MAY BE USEDTC-3 ENTRANCE / OUTLET TIRE WASHN.T.S.PAVED ROADWAYMATCH EXISTING GRADEWASH ROCKBAABWATER SUPPLY &HOSECRUSHED AGGREGATE GREATER THAT 3" BUTSMALLER THAN 6"50' MIN.OR FOUR TIMES THE CIRCUMFERENCEOF THE LARGEST CONSTRUCTIONVEHICLE TIRE, WHICHEVER ISGREATER10' MIN OR AS REQUIRED TOACCOMMODATEANTICIPATEDTRAFFIC, WHICHEVERBBSECTION B-BEXISTING PAVED ROADWAYDITCHFILTER FABRIC-12" MIN. UNLESS OTHERWISE SPECIFIEDBY SOILS ENGINEERR=20' MIN.ORIGINAL GRADETC-1 STABILIZED CONSTRUCTION ENTRANCE/EXITN.T.S.N.T.S.MATCH EXISTING GRADEIS GREATER.24' MIN.NOTE:CONSTRUCT SEDIMENT BARRIERAND CHANNELIZE RUNOFF TOSEDIMENT TRAPPING DEVICE-12" MIN. UNLESSOTHERWISE SPECIFIEDBY SOILS ENGINEERCORRUGATED STEEL PANELSFILTER FABRICORIGINAL GRADECRUSHED AGGREGATE GREATER THAT 3" BUTSMALLER THAN 6"SECTION A-AN.T.S.CORRUGATED STEEL PANELSSEDIMENT TRAPPINGDEVICEAASE-10 STORM DRAIN INLET PROTECTION - TYPE 1N.T.S.NOTES:1. FOR USE IN AREAS WHERE GRADING HAS BEEN COMPLETED AND FINAL SOIL STABILIZATION ANDSEEDING ARE PENDING SHAPE BASIN SO THAT LONGEST INFLOW AREA FACES LONGEST LENGTH OFTRAP2. NOT APPLICABLE IN PAVED AREAS3. NOT APPLICABLE WITH CONCENTRATED FLOWSSHEET FLOWLESS THAN 1 ACRESHEET FLOWSHEET FLOW6' MIN OVERLAP ATENDS OF SILT FENCEAAGEOTEXTILE BLANKETSILT FENCE PER SE-01PLANSECTION A-ADRAIN INLETGEOTEXTILE BLANKET24" +/-SE-10 STORM DRAIN INLET PROTECTION - TYPE 2N.T.S.NOTES:1. FOR USE IN CLEARED AND GRUBBED AND IN GRADED AREAS2. SHAPE BASIN SO THAT LONGEST INFLOW AREA FACES LONGEST LENGTH OF TRAP3. FOR CONCENTRATED FLOWS SHAPE BASIN IN 2:1 RATIO WITH LENGTH ORIENTED TOWARDS DIRECTION FLOWEDGE OF SEDIMENT TRAPAADRAIN INLETGEOTEXTILE BLANKETSILT FENCE PER SE-01ROCK FILTER (USE IF FLOW ISCONCENTRATED)SHEET FLOWSHEET FLOWSHEET FLOWPLAN12"-24" MAX4'STABILIZE AREA AND GRADE UNIFORMLYAROUND PERIMETERSECTION A-ANOTE:REMOVE SEDIMENT BEFOREREACHING ONE-THIRD FULL1:1 SLOPE1:1 SLOPE80Page 465 RED CURB W/ WHITELETTERING "FIRE LANE"EVERY 30' (TYP)EX ENTRY ROAD54' RELOCATED FIRE HYDRANTFROMTO12.4%6.3%22' NEWENTRY ROADR = 52'AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF P R O J E C T AREA NOT PARTOF PROJECT60' S C V W D E A S E M E N T 10' SEWER EASEMENT40.26' PUBLIC STREET EASEMENT40' RO A D E A S E M E N T AREA NOT PARTOF PROJECTFIRE ACCESS PLANCM/TUAS SHOWNCM/TUDRAWN BY:PROJECT NO:CAD DWG FILE:CHECKED BY:DESIGNED BY:DATE:SCALE:HMHCDATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504FA.DWG454504FA.DWGC6.04545.04JANUARY 17, 202580PLOTTED: 4/9/2025 2:18 PMOFLand Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand SurveyingStormwater Compliance1570 Oakland Road(408) 487-2200San Jose, CA 95131HMHca.com1 3/28/2025 PER TOWN COMMENTS1 INCH = 20 FEET4020100KEYMAPSCALE: 1" = 1000'ENTRY ROADAREA OF WORKSTRIPING NOTES:1. ALL STRIPING, MARKINGS AND SIGNING INSTALLATION TO BE PERFORMED BY THE CONTRACTOR. (EXCEPT AS NOTED)2. UNLESS INDICATED OTHERWISE, ALL SIGN TYPES SHOWN ON THIS PLAN ARE PER THE 2014 CALIFORNIA MUTCD.3. ALL TEMPORARY STRIPING AND PAVEMENT MARKINGS MUST BE REINSTALLED BACK TO ORIGINAL CONFIGURATION UPONPROJECT COMPLETION.1Page 466 AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT40' ROAD EASEMENTSHEETS A0-3, AO-5, AO-7, AO-9SHEETS A0-2, AO-4, AO-6, AO-8111810171615141312126543789Sheet:AO-1Scale:1" = 150'Date:rev 1: 3/28/25Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North 075 150 300 450OVERALL PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comLa RINCONADA GOLF COURSEMODERNIZATION PROJECT1/17/25Page 467 350355360365370375380375380 385 340345350355350 350 355 360 365 370 375380 350 350 350355360365370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370370365 365 355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400 400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330345350355360365370 300305310380375370365360355350350345335325 340345350 355345340335 36069 67AROAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT10' SEWER EASEMENT40' ROAD EASEMENT11181017161514131289111810171615141312126543789Sheet:Scale:Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North DEMOLITION PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comREMOVE 7,183 S.F. OFCONCRETE CART PATH1" = 100'050 100 200 300UTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.REMOVE 9,068 S.F. OFCONCRETE CART PATHREMOVE 7,928 S.F. OFCONCRETE CART PATHREMOVE 10,551 S.F. OFCONCRETE CART PATHREMOVE 9,919 S.F. OFCONCRETE CART PATHREMOVE 10,317 S.F. OFCONCRETE CART PATHREMOVE 9,386 S.F. OFCONCRETE CART PATHREMOVE 2,317 S.F. OF CONCRETE CART PATHREMOVE 2,846 S.F. OF CONCRETE CART PATHREMOVE 2,859 S.F. OFCONCRETE CART PATHREMOVE 2,119 S.F. OF ASPHALT CART PATHREMOVE 2,676 S.F. OF ASPHALT CART PATHREMOVE 1,285 S.F. OF ASPHALT CART PATHLa RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-2SEE SHEET A0-3LIMITS OF DISTURBANCE (TYP)EXISTING 5' CONTOUR (TYP)EXISTING 1' CONTOUR (TYP)1/17/25LEGENDLIMITS OF DISTURBANCEPROPOSED CONCRETE CART PATH TO BE REMOVEDWORK AREAPROPOSED ASPHALT CART PATH TO BE REMOVEDEXISTING CART PATHNOTESSEE SHEET AO-11 FOR ADDITIONAL CART PATHINFORMATION.TREE TO BE REMOVEDEXISTING TREE CANOPYrev 1: 3/28/25Page 468 275280285290295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280285290295300305310315320 325 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 350 350 355 360 365 370 375380 350 350 350 355 360 365 370 370 365375 375 380 380 380 380 380 380 375 370365355 330 325 330 335 340 345 350 355 360 365 370 280285280290295300 305 310 315 320 285 290 295 300 305 310 285290 295 300305 310 315 320 325 330 335 280 280 275 275 28 0 380375370365360355350350345335325 340 345 350 355 345 34033536069 67 270 2 2 8 0 AREA NOT PARTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT111810126543789111810171615141312126543789Sheet:Scale:Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North DEMOLITION PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.com1" = 100'050 100 200 300UTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.REMOVE 2,577 S.F. OFCONCRETE CART PATHREMOVE 4,531 S.F. OFASPHALT CART PATHREMOVE 12,290 S.F. OFCONCRETE CART PATHREMOVE 7,264 S.F. OF CONCRETE CART PATHREMOVE 11,090 S.F. OFCONCRETE CART PATHREMOVE 2,279 S.F. OFCONCRETE CART PATHREMOVE 3,114 S.F. OF CONCRETE CART PATHREMOVE 4,130 S.F. OFCONCRETE CART PATHREMOVE 7,422 S.F. OFCONCRETE CART PATHLa RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-3SEE SHEET A0-2LIMITS OF DISTURBANCE (TYP)EXISTING 5' CONTOUR (TYP)EXISTING 1' CONTOUR (TYP)1/17/25NOTESSEE SHEET AO-11 FOR ADDITIONAL CART PATHINFORMATION.LEGENDLIMITS OF DISTURBANCEPROPOSED CONCRETE CART PATH TO BE REMOVEDWORK AREAPROPOSED ASPHALT CART PATH TO BE REMOVEDEXISTING CART PATHTREE TO BE REMOVEDEXISTING TREE CANOPYrev 1: 3/26/25Page 469 350355360365370375380375380 385 340345350355350 350 355 360 365 370 375380 350 350 350355360365370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370370365 365 355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400 400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330345350355360365370 300305310380375370365360355350350345335325 340345350 355345340335 36069 67 381395393390385361362370371370375365360365360355357361365370380375385380375370365 348347349395390385365360372373378375370365375376377366365360366365364372 381378377 382380385389375366AROAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT10' SEWER EASEMENT40' ROAD EASEMENT11181017161514131289111810171615141312126543789Sheet:Scale:Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North GRADING PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.com1" = 100'050 100 200 300La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-4UTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.SEE SHEET A0-3LEGENDTURF CONVERSION TO NATIVE PLANT MATERIALPROPOSED GOLF FEATURE - BUNKERPROPOSED GOLF FEATURE - TEEPROPOSED GOLF FEATURE - GREENPROPOSED GOLF FEATURE - FAIRWAY GRASSPROPOSED GOLF FEATURE - ROUGH GRASSTURF CONVERSION TO MULCH1/17/25TURF CONVERSION TO NATIVE GRASSrev 1: 3/28/25Page 470 275280285290295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280285290295300305310315320 325 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 350 350 355 360 365 370 375380 350 350 350 355 360 365 370 370 365375 375 380 380 380 380 380 380 375 370365355 330 325 330 335 340 345 350 355 360 365 370 280285280290295300 305 310 315 320 285 290 295 300 305 310 285290 295 300305 310 315 320 325 330 335 280 280 275 275 28 0 380375370365360355350350345335325 340 345 350 355 345 34033536069 67 270 2 2 8 0300305 0365 348347349336335343335338330 325320315313312310305300295290295310315310305300 295290285280293295290292292290285280280287286285304305378375370375376377366365360366365364372 381378377 382380385389375366AREA NOT PARTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT111810126543789111810171615141312126543789Sheet:Scale:Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North GRADING PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.com1" = 100'050 100 200 300La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-5SEE SHEET A0-21/17/25LEGENDTURF CONVERSION TO NATIVE PLANT MATERIALPROPOSED GOLF FEATURE - BUNKERPROPOSED GOLF FEATURE - TEEPROPOSED GOLF FEATURE - GREENPROPOSED GOLF FEATURE - FAIRWAY GRASSPROPOSED GOLF FEATURE - ROUGH GRASSTURF CONVERSION TO MULCHTURF CONVERSION TO NATIVE GRASSUTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.rev 1: 3/28/25Page 471 AROAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT10' SEWER EASEMENT40' ROAD EASEMENT11181017161514131289111810171615141312126543789Sheet:Scale:1" = 100'Date:Notes:Prepared For:Designed By:FEATURES PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comCopyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.North 050 100 200 300NEW TEE (TYP.)NEW CART PATH CONCRETE (TYP.)10' WIDE (ORANGE DASHED LINE)NEW/REBUILT BUNKER (TYP.)TURF REDUCTION ZONE (TYP.)SEE PLANS BY PINNACLE DESIGN CO.NEW GREEN (TYP.)NEW CART PATH CONCRETE (TYP.)8' WIDE (BLACK DASHED LINE)NEW FAIRWAY (TYP.)REALIGNED ENTRY ROADPLANS BY OTHERSPUTTING GREENLAKE REBUILDSEE PLANS BY OTHERS.LAKE REBUILD & EXPANDSEE PLANS BY OTHERS.MEADOW ZONE (TYP.)La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-6UTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.SEE SHEET A0-31/17/25LEGENDTURF CONVERSION TO NATIVE PLANT MATERIALPROPOSED GOLF FEATURE - BUNKERPROPOSED GOLF FEATURE - TEEPROPOSED GOLF FEATURE - GREENPROPOSED GOLF FEATURE - FAIRWAY GRASSPROPOSED GOLF FEATURE - ROUGH GRASSTURF CONVERSION TO MULCHTURF CONVERSION TO NATIVE GRASSNEW CART PATH CONCRETEWIDTH VARIESrev 1: 3/28/25Page 472 AREA NOT PARTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT111810126543789111810171615141312126543789Sheet:Scale:1" = 100'Date:Notes:Prepared For:Designed By:FEATURES PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comCopyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.North 050 100 200 300NEW TEE (TYP.)NEW CART PATH CONCRETE (TYP.)10' WIDE (ORANGE DASHED LINE)NEW/REBUILT BUNKER (TYP.)TURF REDUCTION ZONE (TYP.)SEE PLANS BY PINNACLE DESIGN CO.NEW GREEN (TYP.)NEW CART PATH CONCRETE (TYP.)8' WIDE (BLACK DASHED LINE)NEW FAIRWAY (TYP.)REALIGNED ENTRY ROADPLANS BY OTHERSPUTTING GREENLAKE REBUILD & EXPANDSEE PLANS BY OTHERS.MEADOW ZONE (TYP.)La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-7SEE SHEET A0-21/17/25LEGENDTURF CONVERSION TO NATIVE PLANT MATERIALPROPOSED GOLF FEATURE - BUNKERPROPOSED GOLF FEATURE - TEEPROPOSED GOLF FEATURE - GREENPROPOSED GOLF FEATURE - FAIRWAY GRASSPROPOSED GOLF FEATURE - ROUGH GRASSTURF CONVERSION TO MULCHTURF CONVERSION TO NATIVE GRASSUTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.rev 1: 3/28/25Page 473 AROAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT10' SEWER EASEMENT40' ROAD EASEMENT11181017161514131289111810171615141312126543789Sheet:Scale:Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North GRASSING PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comGREENS -SEED BENTGRASS (TYP.)ROUGHS -SEED RYEGRASS (TYP.)FAIRWAYS -SOD BERMUDAGRASS (TYP.)TEES -SOD BERMUDAGRASS (TYP.)1" = 100'050 100 200 300BUNKER LIPS -SOD FESCUE (TYP.)MEADOW ZONES -HYDROSEED FESCUE (TYP.)La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-8UTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.SEE SHEET A0-31/17/25LEGENDTURF CONVERSION TO NATIVE PLANT MATERIALPROPOSED GOLF FEATURE - BUNKERPROPOSED GOLF FEATURE - TEEPROPOSED GOLF FEATURE - GREENPROPOSED GOLF FEATURE - FAIRWAY GRASSPROPOSED GOLF FEATURE - ROUGH GRASSTURF CONVERSION TO MULCHTURF CONVERSION TO NATIVE GRASSrev 1: 3/28/25Page 474 AREA NOT PARTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT111810126543789111810171615141312126543789Sheet:Scale:Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North GRASSING PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comGREENS -SEED BENTGRASS (TYP.)ROUGHS -SEED RYEGRASS (TYP.)1" = 100'050 100 200 300BUNKER LIPS -SOD FESCUE (TYP.)FAIRWAYS -SOD BERMUDAGRASS (TYP.)TEES -SOD BERMUDAGRASS (TYP.)MEADOW ZONES -HYDROSEED FESCUE (TYP.)La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-9SEE SHEET A0-21/17/25LEGENDTURF CONVERSION TO NATIVE PLANT MATERIALPROPOSED GOLF FEATURE - BUNKERPROPOSED GOLF FEATURE - TEEPROPOSED GOLF FEATURE - GREENPROPOSED GOLF FEATURE - FAIRWAY GRASSPROPOSED GOLF FEATURE - ROUGH GRASSTURF CONVERSION TO MULCHTURF CONVERSION TO NATIVE GRASSUTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.rev 1: 3/28/25Page 475 Sheet:Scale:ntsDate:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:EARTHWORKS EXHIBIT18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comEARTHWORK PLAN STATEMENTTHE EARTHWORK QUANTITIES AND COLORCODED CUT & FILL AREAS SHOWN ON THIS PLANARE BASED ON THE EXISTING AND PROPOSEDCONTOURING SHOWN ON THE PERMITDRAWINGS. THIS INFORMATION SHALL BE USEDBY THE GOLF COURSE CONTRACTOR TO PLANTHE GRADING OPERATIONS AND OVERALLEXCAVATION & FILL REQUIREMENTS FOR THEPROJECT TO ACHIEVE A BALANCED EARTHWORKOPERATION.THE GOLF COURSE CONTRACTOR SHALL USETHE INFROMATION SHOWN ON THIS SHEET TOADJUST THE SHOWN PROPOSED CONTOURING,APPROXIMATELY 3 TO 6 INCHES, TO ACHIEVE ABALANCED EARTHWORK OPERATION OFAPPROXIMATELY 52,300 CUBIC YARDS CUT AND52,300 CUBIC YARDS FILL.NO OFF HAUL OR IMPORT OF NATIVE SOIL ISANTICIPATED FOR THE PROJECT SCOPE.La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-101/17/25rev 1: 3/28/25Page 476 AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECT40.26' PUBLIC STREET EASEMENT60' SCVWD EASEMENT10' SEWER EASEMENT40' ROAD EASEMENT111810171615141312126543789Sheet:Scale:1" = 150'Date:Notes:Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.Prepared For:Designed By:North 075 150 300 450CART PATH PLAN18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comLEGENDCART PATH REMOVED - CONCRETECART PATH REMAINS. WIDTHS & MATERIALS VARY.QUANTITIES123,071 S.F. TOTAL CART PATH REMOVED103,130 S.F. TOTAL CART PATH INSTALLEDLa RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-111/17/25NEW CONCRETE CART PATH 8' WIDENEW CONCRETE CART PATH 10' WIDECART PATH REMOVED - ASPHALTCART PATH TO REMAIN12' WIDE ASPHALTCART PATH TO REMAIN8' WIDE CONCRETECART PATH TO REMAIN20' WIDE ASPHALTUTILITY NOTEALL UTILITIES SHOWN ARE APPROXIMATE ANDBASED ON FILES RECEIVED FROM CLUB.DESIGNER DOES NOT REPRESENT THESE AREACCURATE OR COMPLETE.rev 1: 3/28/25Page 477 TYPICAL TEE SECTIONTYPICAL DRAINAGE SYSTEM TEES AND BUNKERSTYPICAL BUNKER DRAINAGEALL DRAIN PIPE INSIDE OF BUNKER SHALL BE 4"PERFORATED N12 OR EQUIVALENT. ALL DRAINPIPE OUTSIDE OF BUNKER SHALL BE SOLID N12CPEP OR EQUIVALENT.TRENCHES SHALL BE 6" WIDE AND 8" DEEP. LINEALL TRENCHES WITH GRAVEL BEFORE INSTALLINGPERFORATED PIPE. BACKFILLED TRENCH TO BEFLUSH WITH SUB-GRADE.77 767574737674737776757873757674TYPICAL CATCH BASINROUGH GRADINGTYPICAL CATCH BASINSEED BED PREPSheet:Scale:NTSDate:Notes:Prepared For:Designed By:CONSTRUCTION DETAILSTYPICAL BUNKER SECTIONDIRECTIONOF PLAY18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.com4" CPEP OUTFALLGRAVEL FILLED TRENCHESWITH 4" PERFORATED N124" SOLID CPEPTURN UP AND CAP FOR FLUSHOUTMARK WITH 2 WRAPS OF TRACE WIRE4" PERFORATED CPEPN12 OR EQUIVALENT4" WYE4" END CAPSODFOR TYPE AND PLANTING METHODSEE SPECIFICATIONSSOD TEE SURROUNDS3:1 SLOPE MAXIMUMCOMPACTEDSUB-GRADEFINISHED GRADE1% SLOPE LASER VERIFIEDFOR TYPE AND DEPTH OF TEE MIXSEE SPECIFICATIONSOD BUNKERCOMPLEXCOMPACTEDSUB-GRADEDEPTH OF TOPSOIL @ LIP CAN VARY DUETO DESIRED IRREGULAR LIP HEIGHT(TO BE DETERMINED IN FIELD)6" LOOSE SAND AT INSTALLATION(4" COMPACTED)2% MIN SLOPE AT BOTTOM OFSUB-GRADE TO DRAIN LINEBACKFILL TRENCHWITH GRAVEL4" PERFORATED CPEPN12 OR EQUIVALENTTOPSOILEXTEND RISER 2'-4'ABOVE GRADEBACKFILL WITHAPPROVED GRAVELCOMPACTEDSUB-GRADEDOUBLE WALL CPEP(SIZE VARIES)12" END CAP AND/ORSET RISER IN CONCRETETO SEALPILE GRAVEL AROUND RISERUNTIL READY FOR GRASSING12" PERFORATED N12OR EQUIVALENT TO A MIN.DEPTH OF 2'12" NON-PERFORATED N12OR EQUIVALENTDRILL HOLE TO MATCH PIPE SIZE.SEAL WITH 'GREAT STUFF'EXPANDING FOAM OR EQUIVALENTREMOVE EXCESS GRAVEL,FINISH GRADE TO DRAIN,CUT RISER AND INSTALLCAST IRON GRATE.SOD "2 RINGS" WIDEAROUND ALL BASINSCOMPACTEDSUB-GRADESUB GRADE SLOPE 1%TO MATCH SLOPE OF TEE TOPSEE SPECIFICATIONS FORBUNKER LINER DETAILS.Copyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-121/17/25rev 1: 3/28/25Page 478 6"15.0' MAX8"TYPICAL DRAINAGE LAYOUTTYPICAL FINISHED GREENTYPICAL GREEN CAVITY12-16"12"4"TYPICAL CLEAN-OUT DETAILTYPICAL GREEN DRAIN CONNECTIONSheet:Scale:NTSDate:Notes:Prepared For:Designed By:CONSTRUCTION DETAILS18022 Cowan, Suite 200Irvine,California 92614 USAp:(949) 476-6878 f:(949) 476-6875www.originsgolfdesign.comTYPICAL DRY SUMPPLACE IN OUT OF PLAY AREAS WHEN POSSIBLE6'-0"6'-0"4" CARRY OFF DRAINAGEFROM GOLF FEATURECOMPACTED SUB-GRADESOD "2 RINGS" WIDE AROUND BASIN12" DIAMETER CAST IRON GRATESET ON TOP OF PIPE2" NATIVE SOIL OVER GRAVEL12" PERFORATED RISERBACKFILL WITH APPROVED GRAVEL12" END CAPDRILL HOLE TO MATCH PIPE SIZESEAL WITH 'GREAT STUFF'EXPANDING FOAM OR EQUILAVENTFINISHED GRADECOMPACTEDSUB-GRADEFINISHED GRADECOMPACTEDSUB-GRADEDRAINAGE TRENCHCOMPACTEDSUB-GRADE4" GRAVEL BLANKET4" PERFORATEDDRAIN PIPE N-12 OR EQUALGREENS MIXCOMPACTED TO 12"GREENS MIX30 MIL PVCGREEN LINERFINISHED GRADECAP AT FINISHED GRADEWITH TORO 850-00 VALVE COVEROR EQUAL4" SOLID CPEPDOUBLE WALL4" 45°4" SOLID CPEPDOUBLE WALLCOMPACTEDSUB-GRADE4" GRAVEL BLANKETGRAVEL FILLED TRENCH4" PERFORATED CPEPN-12 OR EQUALFINISHED GRADEGREENS MIX30 MIL PVCGREEN LINER4" GRAVEL BLANKETGRAVEL FILLED TRENCH4" PERFORATED CPEPN-12 OR EQUAL4" 45°COMPACTEDSUB-GRADE4" WYE4" ELBOW4" SOLID CPEP DOUBLE WALLCARRY-OFF LINE4" TEE FOR"SMILE" DRAINCopyright 2025. Todd Eckenrode - Origins GolfDesign expressly reserves the common law andstatutory copyright and other property rights inthese plans. These plans are not to be used,reproduced, changed or copied in any form ormanner whatsoever, nor may they be assigned toany third party, without first obtaining the express,written consent and permission of ToddEckenrode - Origins Golf Design.These drawings as prepared by the Golf CourseArchitect are the Instruments of Service for usesolely with respect to this project. The GolfCourse Architect shall be deemed the authorsand owners of their respective Instruments ofService and shall retain all common law, statutoryand other reserved rights, including copyrights.No other right to use Instruments of Service shallbe deemed granted or implied. The Owner, hispartners, heirs, successors or assigns shall notuse the Instruments of Service unless the Ownerobtains the prior written Agreement of the GolfCourse Architect to do so specifically. Anyunauthorized use of the Instrument of Serviceshall be at the Owner's sole risk. The Golf CourseArchitect shall not be liable for, or responsible forany such un-approved use or change.La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-131/17/25rev 1: 3/28/25Page 479 ($57+&203$&7('),//;<$$$&21&5(7(6$1'0257$5$/80,18067((/),1,6+:22'528*+:22'&217,18286:22'%/2&.0(7$/678'3/<:22'%$77,168/$7,215,*,',168/$7,21*<3680:$//%2$5'6327(/(9$7,21; ;;0$7&+/,1(&21752/32,17'$7805(9,6,217$*&/28'.(<127(7$*),1,6+7$*:,1'2:7$*L'2257$*(;7(5,25(/(9$7,21180%(56+((7180%(5'(7$,/180%(56+((7180%(5$$%8,/',1*6(&7,21180%(56+((7180%(5$:$//6(&7,21180%(56+((7180%(5,17(5,25(/(9$7,21180%(56+((7180%(552201$0(5220180%(55RRPQDPH',0(16,2172)$&(2)6758&785(',0(16,2172&(17(5/,1(',0(16,2172)$&(2)),1,6+3523(57</,1(&2/8015()(5(1&(*5,'6&/($59,(:'5:,0%/('21'5 :,1&+(67(5%/9'+:<+:<$5($2):25.,)3&,668(')253/$1&+(&.,)56,668(')255(68%0,77$/Ƒ68%0,77(':,7+2875(9,6,21Ŷ68%0,77(':,7+5(9,6,2112768%0,77('5(029(')5206(7$%%5(9,$7,2166<0%2//(*(1' $1'( (;,67,1*1 1(:3 352326('#$7$& $,5&21',7,21,1*$& $63+$/7,&&21&5(7($&2867 $&2867,&$/$'- $'-867$%/($)) $%29(),1,6+)/225$/7 $/7(51$7($/80 $/80,180$3352; $3352;,0$7($5&+ $5&+,7(&7$5&+,7(&785$/%2 %277202)%: %(7:((1%' %2$5'%.* %$&.,1*%/'* %8,/',1*%/.* %/2&.,1*%27 %27720&$% &$%,1(7&(0 &(0(17&- &216758&7,21-2,17&21752/-2,17&/ &(17(5/,1(&/* &(,/,1*&/2 &/26(7&/5 &/($5&08 &21&5(7(0$6215<81,7&2 &/($1287&2/ &2/801&21& &21&5(7(&211 &211(&7,21&21675 &216758&7,21&217 &217,18286&37 &$53(7&7 &(5$0,&7,/(&75 &(17(5'%/ '28%/('(37 '(3$570(17') '5,1.,1*)2817$,1',$ ',$0(7(5',0 ',0(16,21'1 '2:1'6 '2:163287'63 '5<67$1'3,3('7/ '(7$,/':* '5$:,1*($ ($&+(/ (/(9$7,21(/(& (/(&75,&$/(/(9 (/(9$725(0(5 (0(5*(1&<(1&/ (1&/2685((4 (48$/(48,3 (48,30(17(6 ($&+6,'((: ($&+:$<(;7 (;7(5,25)' )/225'5$,1)'1 )281'$7,21)( ),5((;7,1*8,6+(5)(& ),5((;7,1*8,6+(5&$%,1(7)) ),1,6+)/225),1 ),1,6+)/ )/225)2& )$&(2)&21&5(7()2) )$&(2)),1,6+)5 )5$0()53 ),%(5*/$665(,1)25&('3$1(/)6' ),5(6(3(5$7,21',67$1&()7 )22725)((7)7* )227,1*)855 )855,1**$ *$8*(*$/9 *$/9$1,=('*/ */$66*5 *5$'(*60 *$/9$1,=('6+((707/*<3 *<3680+% +26(%,%%+':5 +$5':$5(+0 +2//2:0(7$/+25,= +25,=217$/+5 +285+7 +(,*+7+9$& +($7,1*9(17,/$7,1* $,5&21',7,21,1*,)+3& ,668()25+($/7+3/$1&+(&.,)3& ,668()253/$1&+(&.,)33& ,668()253/$11,1*3/$1&+(&.,1 ,1&+25,1&+(6,1&/ ,1&/8'(,168/ ,168/$7,21,17 ,17(5,25,19 ,19(57&/,(17/$5,1&21$'$&28175<&/8%&/($59,(:'5/26*$726&$$1'<.,0%$//(DNLPEDOO#ODULQFRQDGDFFFRP$5&+,7(&7($5&+,7(&785(25&+$5'&,7<'5,9(67(&$03%(//&$-())5(<($721$,$3(MHIIUH\#HDVWXGLRFRP9,&,1,7<0$36+((7180%(56+((71$0(,)3&B6*(1(5$/,1)250$7,213$ *(1(5$/,1)250$7,213$ %/8(35,17)25$&/($1%$<$5&+,7(&785$/3$ 29(5$// (1/$5*('352326('6,7(3/$13$ 352326(')/2253/$13$ 352326('',0(16,21(')/2253/$1 :$//7<3(63$ 352326('522)3/$13$ 352326('(;7(5,25(/(9$7,2163$ 352326(')) ()/2253/$1 (/(9$7,2163$ 352326('5()/(&7('&(,/,1*3/$1-$1 -$1,725-7 -2,17/$% /$%25$725</$0 /$0,1$7(/$9 /$9$725</% 3281'/) /,1($5)((7/* /$5*(/7 /,*+705 02,6785(5(6,67$170$7 0$7(5,$/0$; 0$;,0800(&+ 0(&+$1,&$/0(0% 0(0%5$1(0(== 0(==$1,1(0)5 0$18)$&785(50,1 0,1,0800,6& 0,6&(//$1(28607' 02817('07/ 0(7$/08/ 08//,211,& 127,1&2175$&712 180%(5120 120,1$/16 126&$/(176 127726&$/(2 29(52$ 29(5$//2& 21&(17(52&& 2&&83$1&<2)' 29(5)/2:'5$,12+ 23326,7(+$1'231* 23(1,1*232, 2:1(53529,'('2:1(5,167$//('3/$0 3/$67,&/$0,1$7(3,3 3285(',13/$&(3.* 3$5.,1*3/ 3/$7(3/$6 3/$67(53/<:' 3/<:22'37 32,175$' 5$',865' 522)'5$,15() 5()(5(1&(5()5 5()5,*(5$7255(,1) 5(,1)25&('5(4 5(48,5('50 522052 528*+23(1,1*5:/ 5$,1:$7(5/($'(56$1 6$1,7$5<6& 62/,'&25(6&' 6((&,9,/'5$:,1*66&+(' 6&+('8/(6(& 6(&7,216(' 6(((/(&75,&$/'5$:,1*66+7 6+((76+:5 6+2:(56,0 6,0,/$56/' 6((/$1'6&$3('5$:,1*660' 6((0(&+$1,&$/'5$:,1*662* 6/$%21*5$'(63' 6((3/80%,1*'5$:,1*663(& 63(&,),&$7,2164 648$5(66 67$,1/(6667((/66' 6((6758&785$/'5:$,1*667' 67$1'$5'67/ 67((/6725 6725$*(6758&7 6758&785$/6863 6863(1'('69 6+((79,1</6:5 6(:(56<0 6<00(75,&$/6<6 6<67(07 % 723 %277207 * 721*8( *5229(72 7232)7%' 72%('(7(50,1('7(/ 7(/(3+21(7(03 7(0325$5<7+. 7+,&.79 7(/(9,6,217<3 7<3,&$/821 81/(6627+(5:,6(127('81) 81),1,6+('9&7 9,1</&20326,7,217,/(9(57 9(57,&$/9(67 9(67,%8/(9,) 9(5,)<,1),(/': :,'(: :,7+:2 :,7+287:& :$7(5&/26(7:' :22':': :,1'2::* :,5(*/$66:+ :$7(5+($7(5:3 :$7(53522):5 :$7(55(6,67$17:63 :(767$1'3,3(:7 :(,*+7<' <$5'',$0(7(572:12)/26*$726081,&,3$/&2'(&%&&3&&0&&(&&$/,)251,$),5(&2'(:,7+/2&$/$0(1'0(176%8,/',1*(1(5*<()),&,(1&<67$1'$5'6&$/,)251,$*5((1%8,/',1*67$1'$5'62&&83$1&<7<3(2)&216758&7,21$31=21,1*%8,/',1*$5($6,7($5($635,1./(5('%OO%$&5(6)6)5&5(6285&(&216(59$7,2112$5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$*(1(5$/,1)250$7,21/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-(/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$35(9$,/,1*&2'(66+((7,1'(;/(*(1'6+((7,1'(;/(*(1'6&23(2):25.*(1(5$/,1)250$7,21$33529$/67$03352-(&7',5(&725<5HY 'HVFULSWLRQ 'DWH&216758&7,212)1(:5(6752206$7(;,67,1*6,7(6&23(2):25.,1&/8'(6&216758&7,212)1(::$//6),1,6+(6/,*+7,1*522)$1'$662&,$7('3/80%,1*),;785(6)255(675220$&&2002'$7,216&,9,/(1*,1((5&/,))%(&+7(/$1'$662&,$7(6//&7+3/$&(6(6$00$0,6+:$&/,))%(&+7(/33/$11(5+0+(1*,1((562$./$1'52$'6$1-26(&$67(3+$1.8(+13Page 480 $5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$%/8(35,17)25$&/($1%$</$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$5$XWKRU&KHFNHU5HY 'HVFULSWLRQ 'DWHPage 481 3523(57</,1(3/;;;; /(1*7+2)3523(57</,1((;,67,1*3$5.,1*/2752$'*2/)&$5752$'(;,67,1*%8,/',1*127,16&23(3/ 3/ 3/ 3/ 3/ 3/ 3/ 3/ 3/ 3/ 3/ 3$$5($2):25. $5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$29(5$// (1/$5*('352326('6,7(3/$1/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-(.(<127(6/(*(1'3/$11257+758(1257+ 29(5$//352326('6,7(3/$15HY 'HVFULSWLRQ 'DWH (1/$5*('352326('6,7(3/$1Page 482 3$3$%$53$3$3$3$3$3$3$5(6752205(675220)) )) 1(::$//5()(572:$///(*(1'7<3(352326(':,1'2::,1'2:6725()52177$*5()(572:,1'2:6&+('8/(256725()5217/(*(1'352326(''225'2257$*5()(572'2256&+('8/(D$5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$352326(')/2253/$1/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-(3/$1127(6 352326(')/2253/$1.(<127(6 /80%(53(5*2/$$%29(6((522)3/$1/(*(1' 5()(572)) (3/$1)25(48,30(17/$<287',0(16,216(7& 5()(572,17(5,25(/(9$7,216)25$'' /',0(16,216'(6&5,%,1*3$57,$/+7:$//6&$6(:25./$<28763(&,$/7<287/(7/2&$7,216(7& 5()(5725()/(&7('&(,/,1*3/$16)2562)),76&/*+76 3/(180%$55,(5/2&$7,216 5()(572*(1(5$/,1)250$7,21$1'&216752&7,21127(66+((76)25$'' /127(6/(*(1'66<0%2/6$%%5(9,$7,216 6&+('8/(65HY 'HVFULSWLRQ 'DWHPage 483 :$//7<3(678'6,=( :$//+(,*+7) 7281'(56,'(2)6758&$%29(% $%29(+,*+(67$'-&(,/,1*8 81'(5&(,/,1*3 321<:$//+73(5:$//7$*+52)),5(5$7('3+321<:$//+(,*+772),1,6+:+(5(2&&8563$57,7,21:$//6321(52:2)678':21(/$<(52)7<3( ; *<3%'($&+6,'(321(52:2)678':21(/$<(52):$7(55(6,67$17*<3%'21:(76,'($1'21(/$<(52)7<3( ; *<3%'21'5<6,'(321(52:2)678':21(/$<(52):$7(55(6,67$17*<3%'($&+6,'(,17(5,25:$//7<3(6,17(5,25:$//7<3(7$*,17(5,25:$//6( &21&+5),5(5$7(':$//( &21&+5),5(5$7(':$//(21(52:2)0(7$/678':'(16(*/$6621(;76,'((21(52:2)0(7$/678':'(16(*/$6621(;76,'(/$<5(62)7<3(;*<3%'21,176,'((;7(5,25:$//7<3(6(;7(5,25:$//7<3(7$*(;7(5,25:$//6(321<:$//+(,*+772),1,6+:+(5(2&&856:$//7<3(3$3$3$3$ 72&(17(52)3267 3 )1(::$//5()(572:$///(*(1'7<3(/80%(53(5*2/$$%29($5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$352326('',0(16,21(')/2253/$1 :$//7<3(6/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-(.(<127(6 /80%(53(5*2/$$%29(6((522)3/$13/$1127(6/(*(1' 352326('',0(16,21(')/2253/$1:$//7<3(6 5()(572)) (3/$1)25(48,30(17/$<287',0(16,216(7& 5()(572,17(5,25(/(9$7,216)25$'' /',0(16,216'(6&5,%,1*3$57,$/+7:$//6&$6(:25./$<28763(&,$/7<287/(7/2&$7,216(7& 5()(5725()/(&7('&(,/,1*3/$16)2562)),76&/*+76 3/(180%$55,(5/2&$7,216 5()(572*(1(5$/,1)250$7,21$1'&216752&7,21127(66+((76)25$'' /127(6/(*(1'66<0%2/6$%%5(9,$7,216 6&+('8/(65HY 'HVFULSWLRQ 'DWHPage 484 3$3$3$3$ 7<3 $5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$352326('522)3/$1/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-( 352326('522)3/$1 5()(572*(1(5$/,1)250$7,21$1'&216758&7,21127(66+((76)25$'' /127(6/(*(1'66<0%2/6$%%5(9,$7,216 6&+('8/( 5()(5720(3522)723(48,30(17/$<287',0(16,216(7&3/$1127(6/(*(1'.(<127(6 /80%(53(5*2/$ 63$1,6+67</(7(55$&277$&/$<7,/(522),1* *877(5$1''2:1632875HY 'HVFULSWLRQ 'DWHPage 485 &2/25$&(0(173/$67(50$18)$&785(5&2/25%6721(9(1((50$18)$&785(5&2/25&7(55$&277$7,/(522)0$18)$&785(5&2/25'7,0%(575(//,60$18)$&785(5*5281' 522)5,'*( %2)$6&,$ 726721( 7275(//,6 *5281' 522)5,'*( %2)$6&,$ 726721( 7275(//,6 6&21&( $))7<3*5281' 522)5,'*( %2)$6&,$ 726721( 72:,1'2: *5281' 522)5,'*( %2)$6&,$ 726721( $5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$352326('(;7(5,25(/(9$7,216/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-(0$7(5,$//(*(1'.(<127(6 &86720)$%5,&$7(':528*+7,521*5,// 7(;785('35,9$&<*/$665HY 'HVFULSWLRQ 'DWH :(676,'( (;7(5,25(/(9$7,21 )5217 (;7(5,25(/(9$7,21 ($676,'( (;7(5,25(/(9$7,21 %$&. (;7(5,25(/(9$7,21Page 486 &$6(:25.5()(572)) (3/$1),1,6+7$*5()(572),1,6+/(*(1';<$&&(17:$//),1,6+5()(572),1,6+3/$1$&&(6625,(6 3/80%,1*7$*5()(572$&&(6625,(6 3/80%,1*6&+('8/(;<$(/(9$7,210$5.(55(675220%$50,1 0,1 0,1 3$3$3$3$3$3%0,1 5(6752203%3%5$0,1 0,1 0,1 0,1 3%5$5$5$%$%$5$5$5$3%5$5$5$(4(45$5$5$(4(45$5$5$5$5$)) )) *5281' 0$;$))3$3(5',63(16(56 0,55250$;$)) 0$;$)) %2&(,/,1*6((5&3*5281' %2&(,/,1*6((5&3*5281' 0$;$))%2&(,/,1*6((5&3*5281' 0$;$)) %2&(,/,1*6((5&3*5281' %$%$%2&(,/,1*6((5&3$5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$352326(')) ()/2253/$1 (/(9$7,216/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-(/(*(1'.(<127(6 /80%(53(5*2/$$%29(6((522)3/$13/80%,1*),;785(6&+('8/(7$* '(6&5,37,21 &2/25),1,6+ &200(1763% $&&(66,%/()/22502817(':$7(5&/26(7 :+,7( 63'6(($&&(66,%,/,7<6+((7)25$&&(66,%/(5(48,5(0(1763% $&&(66,%/()$8&(7 63'6(($&&(66,%,/,7<6+((7)25$&&(66,%/(5(48,5(0(1763% $&&(66,%/(6,1. :+,7( 63'6(($&&(66,%,/,7<6+((7)25$&&(66,%/(5(48,5(0(176$&&(6625<6&+('8/(7$* '(6&5,37,21 0$18)$&785(5 02'(/ &2/25),1,6+ &200(176%$ 81'(5&2817(55()5,*(5$725 ),6+(5 3$<.(/ 569575$ $&&(66,%/(62$3',63(16(5 .2+/(5&2 .&35$ $&&(66,%/(0,5525:,7+/(' %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(*5$%%$5 %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(*5$%%$5 %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(3$3(572:(/',63(16(5 %2%5,&. %0%/. 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(72,/(73$3(5',63(16(5 %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(3$3(572:(/',63(16(5 75$6+ %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(&2$7+22. %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765$ $&&(66,%/(72,/(76($7&29(5',63(16(5 %2%5,&. % 0$77(%/$&. 5()(572%8,/',1*$&&(66,%,/,7<6+((7)25$&&(66,%,/,7<5(48,5(0(1765HY 'HVFULSWLRQ 'DWH 352326(')/2253/$1 5(675220 :(67 5(675220 1257+ 5(675220 ($67 5(675220 6287+ %$5 1257+Page 487 (4(4 (4(4 5 555(4(4 (4(4 5 555 5 55$5$5(675220%$55(675220 *<3 *<3 *<37$* 6<0%2/ 7<3(127(65,17(5,255(&(66(''2:1/,*+7*<3680%2$5'6327(/(9$7,21:0$7(5,$/; ;;0$7(5,$/7:$//02817('(;,76,*1:(0(5*(1&</,*+7;*<36('6((),1,6+/(*(1')25),1,6+5(;7(5,255(&(66(''2:1/,*+76('5$0,5525:,7+/('3529,'((/(&75,&$/)250,55256('$5&+,7(&785(>/&KZE/KZWKZd/KEϯϬϳKƌĐŚĂƌĚŝƚǇƌ͕͘^ƚĞϯϱϬĂŵƉďĞůů͕ϵϱϬϬϴϰϬϴ͘Ϯϲϱ͘ϱϮϱϱ-())5(<($721$5&+,7(&7,1&($5&+,7(&785(3URMHFW1XPEHU'DWH6KHHW7LWOH&OLHQW'UDZQE\&KHFNHGE\$03$352326('5()/(&7('&(,/,1*3/$1/$5,1&21$'$&20)25767$7,21:('*(:22'$9($1'=(1$$9(/26*$726&$.(9,1%5((10$516-( 352326('5(/(&7('&(,/,1*3/$1/(*(1'5&3127(6.(<127(6 5()(572*(1(5$/,1)250$7,21$1'&216758&7,21127(66+((76)25$'' /127(6/(*(1'66<0%2/6$%%5(9,$7,216 6&+('8/(6 5()(5725()/(&7('&(,/,1*3/$16)2562)),76&/*+76 3/(180%$55,(5/2&$7,216 (;,67,1*6+(// &25(&216758&7,216+2:1Z32&+( 256&5((1('5HY 'HVFULSWLRQ 'DWHPage 488 P 1RW 1DC 1DC 1RW 1RW 1RW 1EU 1RW 1RW 1?? 1ASH1EU 1EU 1EU 1EU 1EU 1RW 1EU 1EU 1EU 1RW 2RW 2EU 1RW 1RW 2AC 3EU 1EU 1EU 1RW 1RW 1RW 1ASH1RW 1?? 1CIP 1RW 1RW 1RW 1LIQ1CIP 1RW 1RW 2RW 2RW 2EU 1RW 2EU 1RW 1RW 3RW 3RW 3RW 1RW 1RW 2C? 2EU 2EU 2RW 2RW 2RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 2RW 2RW 2RW 2RW 2RW 3RW 1RW 1RW 1RW 1B 1B 1RW 3RW 3RW 3ASH 3ASH 3RW 1EU 2RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 2RW 2RW 2RW 2RW 2RW 1?? 1RW 1RW 2RW 2RW 2ASH 2RW 2ASH 1ASH 1RW 2ASH 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 2GP 2P 1RW 2EU 1EU 1EU 1EU 1EU 1EU 1RW 1EU 1EU 1EU 1RW 1RW 1RW 1EU 1EU 1EU 1EU 1EU 1EU 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 3RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 3RW 2RW 2RW 2RW 1RW 1RW 2RW 2RW 2RW 2?? 2?? 1RW 1RW 2RW 2RW 2RW 1RW 1P 2P 2P 2P 298735621W 11W WWWWWWW111W1WWWWWW WWWWWRRRRR11 1213141516171018RRRRWWWWWW114RRRRRRRRRRWWWRWRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRWWWWWWWWWWW CCCCCCRRRRRW WWRWRRRRRRRRRRWWWWWWWWWWWWWW1111WWWWWWWWWWWWRRRRRRRRRRRWWWWWWRRRRRWRRRRRR11W W WWRRRWWWWWWWWWWWW111111WWWRRRRRRRRRRRWRRWRWWWWWWWWWWRRRRWWWW1111WWWWWWW???22RRRRR1111111WWWWWWWWRWRWRRRRRRRRWRWWWWWWWWW3333RRRRWWWW222211RRRWRRRRWRW3333RWWWWW11WRWRWRRRRRRWWWWWWWWWWWWWWWWW11111111WWWW111W 1WW111WWWRWRWRRRRWRW1? ?WWWWW W WWWWWWWWWWWWW W WWWWWWRWRWRRWRWR?????222222W2W 2WRWRRRRR??????????11? ?? ????WRWRRRWRWRRWW111W11WWWRWRWRWWRWWWWWWWW1111RRRWRWRWWW2211W1WWRWRWW11ASH WWWWRR1W1WWWEUEEU WEWWWW221?RRRRRRRU1RWRRU1EUE22221111W1UWURR 44?????? ? RRW11111RWRWRW55555111R2388WWW1WWW1WWWWWRWWWWWWWWWRWWWRWWWR??1W 1RWRR1WW1W 11111WW 11111W RW55RWRRRRRW RW 1RRWRRWRRRRRRRRRRRRRRRRRRRW 1RWW1RWRRRRRW 1WWRWWWWWWWWWWWWWWWWWWRW 1WWSHSSHAS2 W2RWR2RWRW2RWR1U1WRWR1WW W1222WWWRWWW1RRWRRW1WRW RRWWW1WWWW1WWWWWWWWWWWWRR1111111111111W1WWWWWWWWRWRWWWWWRRRR11WWRWR1RW WWW11WRWRWRW1RWRRWRWRW1RWRRRRRRWW 1RRRRRRRWRRRRRRRWRRRRRW 33URRR111H?1H?? 1SU 11WWWWWRRWWRWDC 1D1C 1CW1RWWCWWRW1??RW? 1ERRWWW1RWW1EUE1EWWRR1EU U1W 11RWWWWWWWW WW111UEUE1U UU 1W1RWRWRWRRRRRR1RRWRR1RRWWWWW1W WRRRW2RRWREE1RWWRWR1111111111111111WW1EU1WW1WW1W U1W?RW 111RWRWRRWWWW1RWR166SHW1W WRW333RRAAAWWWRW2222333W3EUW11DCDCRWWRW WWW33WR111122222222222222AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOTPART OFPROJECTAREA NOT PARTOF PROJECT60' SCVWD EASEMENT10' SEWEREASEMENT40.26' PUBLIC STREET EASEMENT40' ROAD EASEMENTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTOWNER:La Rinconada Country ClubINDEX:COVERIRRIGATION PLANSIP-1 THRU IP-5PINNACLE DESIGN COMPANYLa Rinconada Country ClubLANDSCAPE ARCHITECT:KEY MAP:LANDSCAPE CONSTRUCTION DOCUMENTS77935 Calle Tampico, Suite #202La Quinta, CA 92253760-340-4529Origins Golf Design18022 Cowan StreetSuite 200Irvine, CA 92614GOLF COURSE ARCHITECT:PLANTING DETAILSPLANTING PLANSNTSPP-114595 Clearview DriveLos Gatos, CA 95032PROJECT:SHEET TITLE:COVERSHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253COVER SHEETDFKAKA241603-28-25PP-2PP-3PP-4PP-5PD-2PD-2PD-2PD-2IRRIGATION DETAILSWINCHESTER BLVDVASONA LAKECOUNTY PARKLA RINCONADACOUNTRY CLUBQUITO ROADQUITO ROADHWY 85HWY 85HWY 17HWY 17HWY 9HWY 9HWY 17VICINITY MAP:WINCHESTER BLVDIP-6PP-1 THRU PP-5PD-1 THRU PD-2IP-1IP-2IP-3IP-4IP-52117400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA 17400 WEDGEWOOD AVE & 17445 ZENA AVE,LOS GATOS, CA 95032TREE PROTECTION & REMOVAL PLANTP-1 THRU TP-6TD-2 TD-3TD-1TD-4TD-5TD-6TREE INVENTORYTI-1 THRU TI-4TREES 360 DEGREESLisa Edwards18022 Cowan StreetSuite 200Irvine, CA 92614ARBORIST:Page 489 87321SS15QL16SSSSSS202SS19SS18SS1771717111SSS212SSSSS222222SS23SSSSSS24SS25SS26SS29SS28SS27ECEE46ECECECCCC4744EC484848444444444EC50555555555ECECEECEECEECEEEEEECECCCCCCCCCCCC49994ECECECCCC511515555EC82CA53EC54EC78EC76EC77EC75EC74EC72EC83EC84ECEEC855858888QI87EC306EC305SS301SS52SS302SS303SS304FV300300030ECCC88ABAABBBBB89989998998ABBBBBB90C91C929292999C94999C93C95SS96C102SS97SS98SS99SS100SS101FR103QAAQAA104CD105CD106SS107RLLLL79EC80EC81EC67EC63EC64EC66EC65SS62EC61EC60EC69EC58ECECCCEEEECCC57YCCCPYCCYCYYCYCYY59EC56E55EC70EC71717177777SS108SS162SS161BP160FV159QA158CD157SS156SS155SS154SS153SSSSSS152151151SS151QAQA10900100QA110QAQQA112ECBEE113ESS114ESS115ESS116ESS117AM118EC119EN120EN121E122EC123QI124QD125E126E127QD128QD129QD130QD131QD13212222131QDQDQD133QD134EC136QA307QA308QA309SS310QA311QA312QD313ECEEC33833833SS336SS337EC335SS334SSSSSSS333SS3323333SSSSSSSSSSSS3313333333SS3303333EG339EC340PCN341SSSSSSSSSSS342SS343SS344444434SSABAAAAB86QA922XXXXEC68EC73EC135EEC137ECEEEEECE1111111QL946Tree varietyInventory tag number -See Trees360 inventoryExisting tree location andcanopy size.Proposed tree removalQL946Tree Protection fencing(prelim)PROJECT:SHEET TITLE:TP-1SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253TREE PROTECTION & REMOVAL PLAN-------XXXXXXXRMKA1" = 50'-0"KA24163-28-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA MATCHLINE TP-3MATCHLINE TP-2TREE PROTECTION & REMOVAL PLAN LEGENDPage 490 SS15SSSS4S5SS26SS32SS31SS29SS28SS27SS30SSSSSSSSSSS343333SS33ENNNN35EN36ER38ER41EN37EN40EN39SLSLL424EC43ECEC44EC4545454ECC4664ECECECCCC47444SS75858587577SS759595975SS76076ADAAD823382ADAAD761QA762EC763QAAA764EC765555576AD766667676CA767CA768QA7697767QA770ADDADADDD771SSSS7727777ADDADADADADDD7737777777777SS775SSSSSSS774AD776777777QAQAAA777QA7787777SS779AB780PH781PH7828278277877PH783PHPHPPHPHHH784PH785PHPHH7866866867878786PHP66H7877778QA7888888787878PHPHHH789QA790SS829CA830QAQAQAQAAAAA832CA831SS833SS834344343483888SS835QAQAAAAA837SS836EC838QIQQIQIQIQI839QAQQAA840SS841EC842SSSSSSSSSSS843ECECCC866QL867VARIOUS844-865QI8686888868QL869869868QA907QD908QD909QA910QA911QSS912QLQQQL913391QL914FU915QDDDDDD921222292QL920QA922QL917QL91633QL918QL919AD7911791797977PH7933793797977AD792ADADDDD794PH796PH795PHHPHH797779PHHHH798PH800AD7997999979779QA801PH802QAQQQQA803QA804QA806QL805QA807QA8088080808888QA809QA810QAQAAA811QA812812818QI813QI814AD816AD815AD817AD819CA824AD8222282PC82121118288CA825QI8268268268268288QA827AD820AD823QA828XXXXAD818ADAAD823233828VARIOUS870-906QD14QL946Tree varietyInventory tag number -See Trees360 inventoryExisting tree location andcanopy size.Proposed tree removalQL946Tree Protection fencing(prelim)SAMPLE TREE VARIETY REFERENCE (SEEARBORIST REPORT FOR MORE FOR MOREINFORMATION)AB,AD= ACACIACD,CA= CEDAREC,EN,ER,EG = EUCALYPTUSFR,FU,FV = ASHLI= CRAPE MYRTLELS= SWEETGUMM= MAGNOLIAOE= OLIVEPCN,PS,PN,PH = PINEPC= PISTACHEPAC= SYCAMORERL= SUMACSS - REDWOODQA,QD,QL,QS = OAKPROJECT:SHEET TITLE:TP-2SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253-------XXXXXXXRMKA1" = 50'-0"KA24163-28-25MATCHLINE TP-1MATCHLINE TP-3TREE PROTECTION & REMOVAL PLAN LEGEND17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLANPage 491 964SS111SSSSS2AAQAQ3333SS4SS5SS6CE7SS9SS8SS10SS291QL11QL12QD1317777171717SS293SSSSSS29222SS290SS289SS288QA28722SS28622SSSSS285SS284152SS151SS150QA149SS147SS148PC164QD163QD165QD1461414141111QD14514141QDDDDD143QDDDDDDDDDD144ECCCCCC141QD142SS166LSS167FV168SS169SS190SS189SSSS187SS184SSSS181SSSSSSSSSS1733377117SS176SS180SS171SS172SS183SS179SS178SS177SS1701171SS185SSSSSSSS186181QD195QD194QD193QA192FV191SS375QAAAAA37677373333SSFVFVFVV66766666MG668WR669QA670QA671PH672FU673OEOOE675767QAQQQAQAAAAAA6744467QDQQDDD688886886686666SS681SS683SS684SS682CA678FU677LJ676OE377777737OE378887378873737OEOEOEEEE379999937OEEEEEE3803383OE38118818838OE382OE38366OEEOOEOOE66EE384448384483838LI704LI703LI7020700707077LI7011001007077LI700777077LI699LI698LI697LI696LI695LILLLILIIII694LI692LI693666966FU69191911169FU690FUUU689868PACAAAC7133717QA714SSSSS715171SS716671PAC717PAC718PAC719PAC720PAC721PAC722PAC723PACPAPPPAPPACCCCC7244272427272PAC725PAC726PAC727OE728PAC729PAC730PAC7311173PACPACAPAPPAPAPP734PAC735PAC736OE737773PK738E739QI7404074SS294SS297SS295SS296SSSSS2989929SSSSS29922922SS361PC362SS360FU359SSSSSSS2652SS266SS267SS268SS269BP270BP271QDQDD273272277SS363SS364SS366SS367SS368SS369SS370SS371SS373SS372SS374SS274SS275SS276SS277SS278SS279SS280SSSSS2812822282SS2838323288SS2823123444444344444SS345SS346SSSSS347734SSSS348434SS350SSSSSS34943343SSSSS3513353SS352FU353SS354SS355PCN356SS357SS358SS317SS318SS319SS316SSSS315331SS314SS320SS321QI328SS322SS324SS325SS323SS329QSS912913QL914915920922QL917916QL919SS326SS327SS365SS188818SSSSSS1747717SS175SS182OE385SS679LJ680SS685AREA OUTSIDE OF PROPOSED PROJECTBOUNDARIES - EXCLUDED FROMPROJECT SCOPE (~ 120 TREES)E138137E139ECEEEEC140FU6866668CA6876666866666QD14PROJECT:SHEET TITLE:TP-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253-------XXXXXXXRMKA1" = 50'-0"KA24163-28-25MATCHLINE TP-4MATCHLINE TP-1SEE SHEETS TP-2 FOR TREE PROTECTION & REMOVAL PLAN LEGEND17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLANPage 492 5101811EB200FV199QD198FV197QI196QD195QA406SS407QD408SS409SS413SS414SMSMM411114SMSM4121414QAAQQAA4100044414SS415SS416SS417SS419SS418QD401SS402SS405SS404CD403SS420SS421SS422SS423SS424SS425QV426642QD427SS606FV397FU396FVFVFFV398399393933SS399SS638FE639FE640SS641FE642FE643FE64566AHHHH644FE646FE647FE648FE650SS649SS651FE652FE654QI655SS653SS656FE657FE658FE659FE660FE661FE662QD400SS560SS562SS561PCN559PCN565SS564SSSSS5666656SS600SS601SS602QD5636555655SS603SS604SS605SS607SS610SS608SS611SS613SSSS61211611SS6146SSSS6176616SS616SS567SS618SS619PCNP5955595SS596SS597SS598SS599FV395FV394FU392SS375FU393SS390SS389SS388SS387SS386638FU391FEFE66336366FV664LJ665FE666FVFVFVV6676666OEOEOEOOO79999937999OEEEE3803383OE382SS444SS445SS446SSSSS447444SSSS44844444SS449SSSSS450545QDQQQQQQQQDDDD4515555145SS452SSSSSS455545SS454CL453EC552EC553EC554EC555RL558RL557RL5565565565555SS569SS568SS594SS593SS592F633636366363SS634SS635QD636SS637MGMMMMG741MGGGMGGMG7424774777444MGGGGGGGGGG74344444474LI705050555555707070LI706LI707LI708LI709LI710LI711PAC712PAC723PACPAPPPAPPACCCCC724427274272772PAC732PAC733SR756SR7577757LI744LI745555574LI746LI747777774BC748BC749749747SRSR753SR754SR755SR752SR750SR751SS201SS202SSSSSSS20320222202SS204SS206SSSSSSSS20700022202QA208208202FU205QA210QA209SS212SS213QA214QA215SSSSS21662212SS217SS218SS219SS220SS221SS222SS223SS224SSSSSSSSS2252222222222SS226SS22777277222SS228SSSS229SSSSS230023SSSSSS231QD232QA233233323LI262QAQA2632QL264SSSSSSS265626EC272SS234SSSSS2363323SS235SS237SS243SS244SS440FV429FVVVV4303343CA431SSSSSSS43244CB433SS434SS435SS436SS437SS438SS439SS44114444SS442SS443SS240SS239SSSSS245LIILI2462482222222248222494222222992492442299992505222222002502220000000025151111251211111125252222225252222525222225352222223325352525225522332545522222225452244ECCCCCCCC428SS241SS24224772477SS609FV932FV933FV934FV935FV936FV937FV938FV939FV940FV941FV942FV943FV944FV945QDDDD946694OE385SSSSS61516661666AREA OUTSIDE OF PROPOSED PROJECTOBOUNDARIES - EXCLUDED FROMDPROJECT SCOPE (~ 29 TREES)EPROJECT SCEPROJECTPEJOAREA OUTSIDE OF PROPOSED PROJECTPUEJOXCLUDED FROMMMBOUNDARIES - EXCLUDEDRPROJECT SCOPE (80 - 100 TREESS)SSPROJECT SCS687666261662222222612622222606222222222260222662225952222222595222225855222222882582252522257522222225722525225522256522222266256522255522222222552225555LILLILLIILIILIILIILIILIILIILIILILILIILIILIILIILIILIISS238PROJECT:SHEET TITLE:TP-4SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253-------XXXXXXXRMKANOT TO SCALE - THIS SHEET ONLYKA24163-28-25MATCHLINE TP-5MATCHLINE TP-3CONTRACTOR TO STUMP GRIND ALL TREE ROOTS TO 24" BELOW EXISTING GRADE.17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLANPage 493 12151617EC474ECECCC475EC476ECCCC477E478E479QA473QL472EC480EC481CD482SS528SS527SS526SS525EC518LI5199951SS520SS521SS522SS523OE52452525SS529SS530EC531EC532EC533EC534EC535EC536EC537EC538EC539EC540EC541SS456EC457EC458EC459ECEECECCCC460066466EC461SS465EC466QD471EC468EC469ECCEECCCC4677746464644EC464EC470SS542SS543EC544EC545EC546EC547EC548EC549EC550EC551552552557557RL5565565565555569SS591SS590SS588SS589SS587SS586SS583SSSSS5845585PCN585PCN627SS628SS629PCN630SS631SS632F633636366363F620OEOE621262OE622OEOEEE623QA624QAAAA625562QAQQAAQAQAAAAA626SS579SS578SS577SS576SS575SS573SS574SS571SS572257SS570SS580SS581SSSSSS58228258255855SS924ECEEEEC4636646ECCEEEECC46222666646PROJECT:SHEET TITLE:TP-5SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253-------XXXXXXXRMKA1" = 50'-0"KA24163-28-25MATCHLINE TP-4MATCHLINE TP-6SEE SHEETS TP-2 FOR TREE PROTECTION & REMOVAL PLAN LEGEND17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLANPage 494 1314479SS483EC484RL487FU486FV485EV497EV496EC495SS494SS493FU488SS489FV490PSSSSSS491CAACACAA492SSSS498SSSS4999949SS500SSSS501501505SS502502505SS503SSSSS504SS505055050SSSSS506650SS507SSSSS508OE509OEOOEE512OE511OE510QA513QAQQAA514QA515EC516EC517EC535EC925EP926ECEC9279929EC928EC929SS930EC931PROJECT:SHEET TITLE:TP-6SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253-------XXXXXXXRMKA1" = 50'-0"KA24163-28-25MATCHLINE TP-5SEE SHEETS TP-2 FOR TREE PROTECTION & REMOVAL PLAN LEGEND17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLANPage 495 PROJECT:SHEET TITLE:TI-1SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY-------XXXXXXXRM24163-28-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREESINVENTORY PRODUCED BY TREES 360 DEGREESARBORIST OF RECORD - LISA EDWARDS77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 496 PROJECT:SHEET TITLE:TI-2SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY-------XXXXXXXRM24163-28-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREESINVENTORY PRODUCED BY TREES 360 DEGREESARBORIST OF RECORD - LISA EDWARDS77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 497 PROJECT:SHEET TITLE:TI-3SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY-------XXXXXXXRM1" = 50'-0"3-28-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREESINVENTORY PRODUCED BY TREES 360 DEGREESARBORIST OF RECORD - LISA EDWARDS77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 498 PROJECT:SHEET TITLE:TI-4SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY-------XXXXXXX24163-28-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREESReason for Tree Removal Per Division 2. - Tree ProtectionSec. 29.10.0992.- Required Findings:(1) The tree is dead, severely diseased, decayed or disfigured to such an extent that the tree is unable to recover or return to a healthyand structurally sound condition.(3) The tree is crowding other protected trees to the extent that removal or severe pruning is necessary to ensure the long-term viabilityof adjacent and more significant trees.(4) The retention of the tree restricts the economic enjoyment of the property or creates an unusual hardship for the property owner byseverely limiting the use of the property in a manner not typically experienced by owners of similarly situated properties, and the applicant hasdemonstrated to the satisfaction of the Director or deciding body that there are no reasonable alternatives to preserve the tree.(10) The removal of the tree and replacement with a more appropriate tree species will enhance the Town's urban forest.Sec. 29.10.0970.- Exceptions:The following trees are excepted from the provisions of this division and may be removed or severely pruned without Town approval or issuance ofa tree removal permit:(2) Any of the following trees that are less than twenty-four (24) inches in diameter (seventy-five (75) inches in circumference):Black Acacia (Acacia melanoxylon)Tulip Tree (Liriodendron tulipifera)Tree of Heaven (Ailanthus altissima)Blue Gum Eucalyptus (E. globulus)Red Gum Eucalyptus (E. camaldulensis)Other Eucalyptus sp. (E. spp.) Hillsides onlyPalm (except Phoenix canariensis)Privet (Ligustrum lucidum)The letter E for Exception is used to identify the removal of a tree that must be identified in the Architectural & Site Review application. However, aTree Removal Permit is not required for removal due to the size and/or undesirable species listed above77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 499 1265437SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #11"1"1"1"-11"-21"461"44-51"5871"8961"91031"10-141"144151"151PROJECT:SHEET TITLE:IP-1SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN-------XXXXXXXDFKA1" = 50'-0"KA24163-28-25MATCHLINE IP-2MATCHLINE IP-3MATCHLINE IP-2SEE SHEET IP-2 FOR IRRIGATION LEGENDSEE SHEET IP-6 FOR IRRIGATION DETAILS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA Page 500 26537SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #11"1"16666-71"77961"1361"13333-141"14SYMBOLMANUFACTURER/MODEL/DESCRIPTIONQTYPSIRAIN BIRD 1802-1400 FLOODFLOOD BUBBLER 2IN. POPUP, INSTALL W/ PA-80 ADAPTER.320 50SYMBOL MANUFACTURER/MODEL/DESCRIPTIONQTYRAIN BIRD XCZ-100-IVMQWIDE FLOW IVM DRIP CONTROL KIT FOR COMMERCIALAPPLICATIONS. 1IN. BALL VALVE WITH 1IN. PESBIVMSMART VALVE W/ FACTORY INSTALLED IVM-SOL 0.3-20GPM AND 1IN. PRESSURE REGULATING 40PSIQUICK-CHECK BASKET FILTER 0.3-20 GPM20HUNTER AFV-TAUTOMATIC FLUSH VALVE WITH 1/2IN. MPT CONNECTION.REMOVABLE TOP FOR DIAPHRAGM MAINTENANCE.40HUNTER PLD-AVRPLD-AVR ALLOWS FOR AIR TO ESCAPE A RESIDENTIAL DRIPIRRIGATION SYSTEM TO PREVENT BLOCKAGE AND WATERHAMMERING. 1/2IN. MPT CONNECTION WITH 80 PSIMAXIMUM RATING.6AREA TO RECEIVE DRIP EMITTERSHUNTER HEB1/2IN. FEMALE THREADED POINT SOURCE DRIP EMITTER.COLOR CODED EMITTERS FOR FLOW RATES OF 0.5 GPH -6.0 GPH. RECOMMENDED PRESSURE FROM 20 PSI-50PSI. OPTIONAL DIFFUSER CAP (HE) AVAILABLE FOR HIGHERFLOWS AND CLOG PROTECTION. ON IH-12 RISER174,345 SFSYMBOL MANUFACTURER/MODEL/DESCRIPTIONQTYRAIN BIRD PESB-IVM1IN., 1-1/2IN., 2IN. PLASTIC INDUSTRIAL SMART VALVESW/ FACTORY INSTALLED IVM-SOL. LOW FLOW OPERATINGCAPABILITY, GLOBE CONFIGURATION. WITH SCRUBBERTECHNOLOGY FOR RELIABLE PERFORMANCE IN DIRTYWATER IRRIGATION APPLICATIONS.29PRESSURE REDUCING VALVE1" ZURN WILKENS 500 XL BRASS PRESSURE REDICINGVALVE36IRRIGATION LATERAL LINE: PVC CLASS 200 SDR 2118,470 LFIRRIGATION MAINLINE: PVC SCHEDULE 402,278 LFPIPE SLEEVE: PVC SCHEDULE 40TYPICAL PIPE SLEEVE FOR IRRIGATION PIPE. PIPE SLEEVESIZE SHALL ALLOW FOR IRRIGATION PIPING AND THEIRRELATED COUPLINGS TO EASILY SLIDE THROUGH SLEEVINGMATERIAL. EXTEND SLEEVES 18 INCHES BEYOND EDGESOF PAVING OR CONSTRUCTION.51.2 LFIRRIGATION SCHEDULEPOINT OF CONNECTION FROM MAINLINE OR SUBMAIN35PROJECT:SHEET TITLE:IP-2SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN------XXXXXXXDFKA1" = 50'-0"KA24163-28-25MATCHLINE IP-1MATCHLINE IP-1NOTE:1. PDC WILL PROVIDE SITE VISITS FORASTHETIC DIRECTION FOR THE GOLFCOURSE LANDSCAPE. PDC WILL BEAVAILABLE TO PROVIDE TECHNICALSUPPORT DURING THE INSTALLATION BYDAYS ON SITE OR THROUGH EMAIL. PDCRECOMMENDS THE GOLF COURSE HIREA LANDSCAPE IRRIGATION FOREMAN TOOVERSEE THE INSTALLATION OF THELANDSCAPE IRRIGATION AND AS-BUILTALL THE NEW LANDSCAPE IRRIGATION TOENSURE THE INSTALLATION IS PER OURDESIGN AND MEETS THE CLUBSEXPECTATION.2. LANDSCAPE CONTRACTOR MUSTTRENCH AND INSTALL THE FIRST THREEVALVES, PIPE AND FITTINGS, LEAVE THETRENCH OPEN FOR REVIEW ANDAPPROVAL PRIOR TO BACKFILLING.LANDSCAPE CONTRACTOR TO DO THISFOR THE SPRAY SYSTEM, THE TREEBUBBLER SYSTEM AND SHRUB DRIPSYSTEM. GOLF COURSESUPERINTENDENT WILL APPROVE ALLLANDSCAPE IRRIGATION.(or equal)(or equal)(or equal)(or equal)(or equal)(or equal)17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA Page 501 89ELECRR1"1"1"1031"11-1"111261"121161"16-171"1716181"1811118823-1"232481"242425-1"2522221"PROJECT:SHEET TITLE:IP-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN-------XXXXXXXDFKA1" = 50'-0"KA24163-28-25MATCHLINE IP-2MATCHLINE IP-417400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA Page 502 111810141312SEE NEXT SHEETFOR PLANTING QTYSRRSEE NOTE #11"1"1"1"1"1941"1920-1"2002181"211113221"22222223-1"232481"242426-1"2627-1"2777777281"283441"4444451"451"PROJECT:SHEET TITLE:IP-4SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN-------XXXXXXXDFKA1" = 50'-0"KA24163-28-25MATCHLINE IP-3MATCHLINE IP-517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA Page 503 171615EX 3-5' TALL RETAINING WALL BLOCKCONCRETE V-DITCHCIS5l17SEE NOTE #1SEE NOTE #1SEE NOTE #11"1"1"1"1"1"1"1"1"1"1"2941"292229999930-1"305311"31115321"323311"333333441"3444444444444435-1"353641"3633363636366361"3781"77373733777777777777773733333333333373737373737373737373737373737373333333333333333333338-1"38333951"3999932401"40044040004040002411"41444-421"424.5431"43PROJECT:SHEET TITLE:IP-5SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN-------XXXXXXXDFKA1" = 50'-0"KA24163-28-25MATCHLINE IP-4SEE IP-5 FOR LEGENDSAND SCHEDULESLOS GATOS, CALIFORNIAPage 504 QUICK COUPLING VALVE BOX, TYP.14"X19" RECTANGULAR VALVE BOX TYP.12" TYP.12"12"12"12"NOTE:3. SET BOXES PARALLEL TO EACH OTHER AND PERPENDICULAR TO EDGE.SECTION VIEW - N.T.S.1. CENTER VALVE BOX OVER REMOTE CONTROLVALVE TO FACILITATE SERVICING VALVE.2. SET RCV AND VALVE BOX ASSEMBLY INGROUND-COVER/SHRUB AREA WHERE POSSIBLE.4. AVOID HEAVILY COMPACTING SOIL AROUND VALVE BOXES TOPREVENT COLLAPSE AND DEFORMATION OF VALVE BOXES.5. COLOR OF BOX TO BE TAN IN THE LANDSCAPE AND GREEN INTURF AREAS(2")(2") MIN.FINISHED GRADEIN SHRUB AREAS(2")FINISH GRADE IN TURF AREASHEAT BRAND "RCV" AND CONTROL STATION # ONTO LID.CAPTIVE STAINLESS STEEL BOLT AND LOC-KIT. INSTALLPLASTIC RECTANGULAR VALVE BOX WITH T-COVER ANDBOX AT RIGHT ANGLE TO ADJACENT HARDSCAPE EDGE.Maxicom WireSCH. 80 PVC SLIPSCH. 40 PVC PIPE ORTAPE WIRE TO PIPESCH. 80 T.O.E. NIPPLE90 DEGREE ELLWITH D.I. SERVICE TEELANDSCAPE FABRIC TO19mm (3/4") CRUSHED GRAVEL,100mm (4") MINIMUM DEPTHCOVER BOTTOM AND ALLSIDES OF VALVE BOXBRICK SUPPORTS,4 REQUIREDLASCO #896 PVC UNIONSLIP X MIPT, SIZE PER RCV,ELECTRIC REMOTE CONTROLVALVE, SEE LEGEND FOR TYPE2 REQUIRED FOR ASSEMBLYSIZE PER PLANS,TYPE PERMIN.PVC PIPE,USE STANDARD BOX OPENINGSFOR PIPE, DONOT CUT BOXLEGEND50 mm50 mm50 mmCABCC CCPRESSURE MAINLINE, SEECONTROL WIRES, SEE SPECS.LATERAL LINES, SEE SPECS.CLEAN COMPACTED BACKFILL(4")(24")CBADIMENSIONFINISH GRADESPECIFICATIONSUNDISTURBED SOILSECTION VIEW - N.T.S.(18") (12")13mm (1/2") TO 65mm (2.5") IN SIZE75mm (3") TO 150mm (6") IN SIZE100mm100mm(4")300mm400mm600mmPRESSURE MAINLINEINSTALLED IN ROCK SOIL.OF THE PIPE OR WIREDETAIL ALSO FOR PIPEIN SCH 40 SLEEVEPVC SLEEVES TO BETWICE THE DIAMETERBUNDLE CARRIED.13mm (1/2") TO 150mm (6") IN SIZEDIMENSION(4")(24")(24")(36")DCBASAND BACKFILL COMPACTEDPAVINGUNDISTURBED SOILTO THE DENSITY OFLATERAL LINESCONTROL WIRESIN SCH 40 SLEEVEIN SCH 40 SLEEVEEXISTING SOILBCDD DDASECTION VIEW - N.T.S.NOTE:SLEEVES TO EXTEND AT LEAST 300mm (12") PAST THE EDGE OF THE PAVING.100mm600mm600mm900mmKIT SHALL INCLUDE A SCOTCHLOK Y SPRING CONNECTOR, A POLYPROPYLENE TUBE AND A WATERPROOF SEALING GEL. TUBE SHALL BE SUPPLIED PREFILLED WITH GEL.WIRE CONNECTOR SHALL BE A 3M DBY-6 DIRECT BURY SPLICE KIT (U.L. APPROVED).NOTE:INSERTED INTO TUBE UNTIL THESCOTCHLOK CONNECTOR AND WIRESCONNECTOR PASSES LOCK TABSWATERPROOF GELPOLY TUBE PRE-FILLED WITHONCE CONNECTOR IS INSERTEDLOCK TABS PREVENT WIRE REMOVAL SCOTCHLOK ELECTRICAL SPRINGCONNECTOR. WIRES SHALL BEPRE-STRIPPED OF 1/2" OF THE INSULATION PRIOR TO INSERTION CONNECTOR ONTO WIRES TO INTO THE CONNECTIOR. TWIST SEAT FIRMLY.IS INSERTED INTO TUBEWIRES PASS THROUGH GROOVES INTUBE LID TO ALLOW LID TO CLOSECLOSE TUBE LID AFTER WIRELOW VOLTAGE WIRES, 3 MAXIMUMSECTION VIEW - N.T.S.DIRECT BURY SPLICE KIT SHALL BE USED TO ELECTRICALLY CONNECT 2 - 3 #14 OR 2 #12 PRE-STRIPPED COPPER WIRES. LARGER WIRES OR GREATER QUANTITIES OF WIRES SHALL REQUIRE A LARGER APPROVED WIRE CONNECTION.LANDSCAPE IRRIGATION MANIFOLD PLAN VIEWLANDSCAPE FABRIC TOCOVER BOTTOM AND ALLSIDES OF VALVE BOXLANDSCAPE FABRIC TOCOVER BOTTOM AND ALLSIDES OF VALVE BOXLANDSCAPE FABRIC TOCOVER BOTTOM AND ALLSIDES OF VALVE BOXHDPE MAINLINE PIPESEE PLAN VIEW FOR LANDSCAPE VALVE ASSEMBLYSECTION VIEW - N.T.S.EXISTING TURFMULCHPROJECT:SHEET TITLE:IP-6SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN------XXXXXXXDFKAKA24163-28-25SEE IP-2 FOR LEGENDSAND SCHEDULES1LOS GATOS, CALIFORNIAPage 505 ZONE D - SCREENING NATIVE(25) Heteromeles arbutifolia(11) Rhus integrifoliaQA-448"box1QA-660"box1QV-448"box1A336"box2A224"box2PR-448"box2QA-448"box1QA-660"box1A336"box1QV-448"box2QV-336"box1A224"box1QA-448"box1QA-41QA-224"box1QA-448"box1QA-336"box1QA-660"box1QA-336"box1PR-660"box1A224"box2A336"box3QA-224"box1xQA-336"box1QA-660"box1QA-448"box2QA-336"box2EX STRUCTURESEE PD-2 FOR TYP. PLANTING ENLARGEMENTSEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1QV-448"box1ZONE B - SCREENING WEDGEWOOD AVE(9) Ceanothus x 'Dark Star'(17) Heteromeles arbutifolia(5) Prunus laurocerasus(9) Rhus integrifolia(7) Tagetes lemmonii(20) Westringia fruticosa 'WES03'MULCH ONLYMULCH ONLYMULCH ONLYQA-660"box1QA-660"box1MULCH ONLYMULCH ONLYYMULCH ONLYMULCH ONLYSEE NOTE #1MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)ZONE A - LOW TO MED DENSITY(5) Caryopteris incana(13) Phlomis fruticosa(2) Rhus integrifolia(10) Trichostema lanatum(16) Westringia fruticosa 'WES03'SEE PD-2 FOR TYP. PLANTING ENLARGEMENTZONE A - LOW TO MED DENSITY(2) Caryopteris incana(4) Phlomis fruticosa(1) Rhus integrifolia(3) Trichostema lanatum(5) Westringia fruticosa 'WES03'SEE PD-2 FOR TYP. PLANTING ENLARGEMENTZONE A - LOW TO MED DENSITY(31) Caryopteris incana(75) Phlomis fruticosa(10) Rhus integrifolia(59) Trichostema lanatum(95) Westringia fruticosa 'WES03'QV-336"box1PROJECT:SHEET TITLE:PP-1SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN-------XXXXXXXDFKA1" = 50'-0"KA241603-28-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAMATCHLINE PP-2MATCHLINE PP-3MATCHLINE PP-2SEE PP-2 FOR LEGENDSAND SCHEDULES, PD-1 FORPLANTING DETAILS/NOTESSEE PD-2 FOR LANDSCAPETYPICAL ENLARGEMENTSPage 506 ZONE D - SCREENING NATIVE(25) Heteromeles arbutifolia(11) Rhus integrifoliaQV-336"box1QA-448"box1QA-660"box1QV-448"box1QA-448"box1QV-336"box1QA-448"box1QA-660"box1QA-224"box1QA-336"box1QA-448"box1QA-224"box1QA-336"box1QV-448"box1QA-660"box1QA-336"box2EX STRUCTURESEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1ZONE C - SCREENING SHADE(4) Ceanothus x 'Dark Star'(20) Heteromeles arbutifolia(7) Prunus laurocerasusMULCH ONLYMULCH ONLYQA-660"box1QA-660"box1MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMEADOMEADOW (BY OTHERS)MEADOW (BY OTHERS)MULCH ONLY272,724 SFNO PLANTINGS. 2" THICK WOOD MULCHZONE A - LOW TO MED DENSITY24,409 SFWITH 2" THICK WOOD MULCHZONE B - SCREENING WEDGEWOOD AVE4,424 SFNO NEW MULCH HERE. PLANT SHRUBS INEXISTING GROUNDCOVER.ZONE C - SCREENING SHADE2,493 SFWITH 2" THICK WOOD MULCHZONE D1 - SCREENING SHED1,245 SFWITH 2" THICK WOOD MULCHZONE D2 - SCREEN BACK OF HOUSE1,955 SFWITH 2" THICK WOOD MULCHZONE E3 - MEADOW PLANTINGS 18G/ROAD 7,894 SFSHRUBS TO BE PLANTED IN MEADOW ZONEAFTER 1 YEAR ESTABLISHMENT OF MEADOWGRASSESZONE F - 11/12/POOL17,028 SFWITH 2" THICK WOOD MULCHZONE G - 8G/9T SHADY2,049 SFWITH 2" THICK WOOD MULCHZONE H - 12 LOW DENSITY30,519 SFNO MULCH - SHRUBS TO BE PLANTED INGRASSLANDSZONE I - SW CORNER SCREENING 9,529 SFWITH 2" THICK WOOD MULCHZONE J - 17T/MAINT 5,097 SFWITH 2" THICK WOOD MULCHZONE K - 17 RIGHT SIDE5,660 SFWITH 2" THICK WOOD MULCHZONE L-1 - 18 RIGHT SIDE19,053 SFWITH 2" THICK WOOD MULCHZONE L-2 - 18 RIGHT SIDE7,649 SFWITH 2" THICK WOOD MULCHWOOD MULCH SPECIFICATION: FOREST FLOORSHRUB PLANTING AREASSEE PLANT SCHEDULE FOR SHRUB VARIETIES, QTYS, ANDSIZES. SEE PLAN FOR SHRUB QTYS AND VARIETIES PER ZONE.MEADOW ZONE WITH NO SHRUB PLANTING (SEEORIGINS GOLF PLANS FOR SPECIFICATIONS)SYMBOLCODEBOTANICAL / COMMON NAMECONTQTYTREESA2ARBUTUS UNEDO / STRAWBERRY TREE SHRUBMULTI-TRUNK OR LOW BRANCHING24"BOX 13A3ARBUTUS UNEDO / STRAWBERRY TREE SHRUBMULTI-TRUNK OR LOW BRANCHING36"BOX 20A4ARBUTUS UNEDO / STRAWBERRY TREE SHRUBMULTI-TRUNK OR LOW BRANCHING48"BOX 6PR-4PLATANUS RACEMOSA / CALIFORNIA SYCAMOREMULTI-TRUNK OR LOW BRANCHING48"BOX 10PR-6PLATANUS RACEMOSA / CALIFORNIA SYCAMOREMULTI-TRUNK OR LOW BRANCHING60"BOX 3QA-2QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING24"BOX10QA-3QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING36"BOX 24QA-4QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING48"BOX27QA-6QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING60"BOX 13QV-3QUERCUS VIRGINIANA / SOUTHERN LIVE OAKFULL AND STANDARD OR LOW BRANCHING36"BOX 8QV-4QUERCUS VIRGINIANA / SOUTHERN LIVE OAKFULL AND STANDARD OR LOW BRANCHING48"BOX 12QV-6QUERCUS VIRGINIANA / SOUTHERN LIVE OAKFULL AND STANDARD OR LOW BRANCHING60"BOX 2QC4QUERCUS VIRGINIANA CATHEDRAL / CATHEDRAL SOUTHERN LIVE OAKFULL, STANDARD48"BOX 6QC6QUERCUS VIRGINIANA CATHEDRAL / CATHEDRAL SOUTHERN LIVE OAKFULL, STANDARD60"BOX 4VINESCISCISSUS ANTARCTICA / KANGAROO VINE5 GAL17SYMBOLCODEBOTANICAL / COMMON NAMECONTSPACINGQTYSHRUB AREASAUARBUTUS UNEDO / STRAWBERRY TREE SHRUB15 GAL 43BBCBUDDLEJA X 'BLUE CHIP' / LO & BEHOLD® BLUE CHIP BUTTERFLY BUSH1 GAL89CAICARYOPTERIS INCANA / COMMON BLUEBEARD5 GAL 41CEDCEANOTHUS X 'DARK STAR' / DARK STAR WILD LILAC5 GAL 141CEJCEANOTHUS X 'JOYCE COULTER' / JOYCE COULTER WILD LILAC5 GAL 16DHDODONAEA VISCOSA / HOPSEED BUSH15 GAL22FRCFRANGULA CALIFORNICA / CALIFORNIA COFFEEBERRY5 GAL71GRRGREVILLEA ROSMARINIFOLIA / ROSEMARY GREVILLEA5 GAL109HAHETEROMELES ARBUTIFOLIA / TOYON15 GAL106LLLEONOTIS LEONURUS / LION'S TAIL5 GAL 41LSLEUCADENDRON X 'SAFARI SUNSET' / SAFARI SUNSET CONEBUSH5 GAL 18MCMYRICA CALIFORNICA / PACIFIC WAX MYRTLE15 GAL10PFPHLOMIS FRUTICOSA / JERUSALEM SAGE1 GAL172PPPHLOMIS PURPUREA / PURPLE PHLOMIS1 GAL43PRLPRUNUS LAUROCERASUS / ENGLISH LAUREL15 GAL 23RIRHUS INTEGRIFOLIA / LEMONADE BERRY5 GAL208SVSYRINGA VULGARIS / COMMON LILAC5 GAL26TLTAGETES LEMMONII / COPPER CANYON DAISY5 GAL7TWTRICHOSTEMA LANATUM / WOOLLY BLUE CURLS1 GAL76WBWESTRINGIA FRUTICOSA 'WES03' / BLUE GEM COAST ROSEMARY5 GAL509PLANT SCHEDULESEE PLANT PROCUREMENT AND APPROVAL NOTES ON SHEET PD-1NOTES:1) TREES PLANTED IN TURF SHALL RECEIVE AWOOD MULCH RING AROUND THE TREE THATEXTENDS 2' BEYOND THE ROOTBALL OF THETREE. CONTRACTOR TO BUILD A 3-4" HIGHWELL INSIDE THE EDGE OF THE MULCH RINGTO HOLD WATER DURING GROW-IN. THE WELLSHOULD BE MAINTAINED FOR AT LEAST AYEAR AFTER PLANTING.NO TREE IN TURF SHALL BE PLANTED WITHIN12' OF A TURF ROTOR.EXISTING TREE TO REMAINSEE TREE DISPOSITION PLANFOR COMPLETE INVENTORY OFTREES TO REMAIN AND TREESTO BE REMOVEDPROJECT:SHEET TITLE:PP-2SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN-------XXXXXXXDFKA1" = 50'-0"KA241603-28-25MATCHLINE PP-1MATCHLINE PP-1SEE PD-1 FOR PLANTINGDETAILS/NOTESSEE PD-2 FOR LANDSCAPETYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 507 ELECZONE D2 - SCREEN BACK OF HOUSE(10) Ceanothus x 'Dark Star'(16) Frangula californica(8) Prunus laurocerasusQA-448"box1QC448"box3QC660"box3QA-336"box1QA-448"box1QA-660"box1QA-336"box1QA-448"box1QA-224"box1A336"box2A224"box1A336"box2A224"box1QC660"box1A224"box2A336"box1QA-448"box1QC448"box3ZONE L-2 - 18 RIGHT SIDE(8) Arbutus unedo(15) Ceanothus x 'Dark Star'(20) Grevillea rosmarinifolia(10) Rhus integrifolia(50) Westringia fruticosa 'WES03'QA-448"box2QA-336"box1EX PUMP HOUSEA224"box2A336"box1A42QA-660"box1QA-448"box1QA-336"box1ZONE F - 11/12/POOL(26) Buddleja x 'Blue Chip'(14) Dodonaea viscosa(27) Leonotis leonurus(12) Leucadendron x 'Safari Sunset'(28) Phlomis fruticosa(46) Westringia fruticosa 'WES03'MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)ZONE E3 - 18 G/ROAD(25) Buddleja x 'Blue Chip'(19) Ceanothus x 'Dark Star'(15) Frangula californica(10) Myrica californica(32) Phlomis fruticosa(25) Rhus integrifoliaSEE PD-2 FOR TYP. PLANTING ENLARGEMENTZONE A - LOW TO MED DENSITY(10) Caryopteris incana(24) Phlomis fruticosa(3) Rhus integrifolia(19) Trichostema lanatum(30) Westringia fruticosa 'WES03'PROJECT:SHEET TITLE:PP-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN-------XXXXXXXDFKA1" = 50'-0"KA241803-28-25MATCHLINE PP-1MATCHLINE PP-4SEE PP-2 FOR LEGENDS AND SCHEDULES, PD-1 FOR PLANTING DETAILS/NOTESMATCHLINE PP-2SEE PD-2 FOR LANDSCAPE TYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 508 QA-660"box1QA-448"box1QA-336"box1QA-448"box1QA-336"box1QA-448"box1QA-224"box2QA-336"box1QA-660"box1QA-448"box1QA-224"box1QA-336"box1QV-336"box1QA-224"box1QA-448"box124 boxQV-336"box1ZONE G - 8G/9T SHADY(7) Ceanothus x 'Dark Star'(13) Frangula californica(3) Prunus laurocerasus(8) Westringia fruticosa 'WES03'SEE NEXT SHEETFOR PLANTING QTYSZONE L-1 - 18 RIGHT SIDE(25) Arbutus unedo(37) Ceanothus x 'Dark Star'(20) Phlomis purpurea(39) Rhus integrifolia(26) Syringa vulgaris(108) Westringia fruticosa 'WES03'LAKELAKEQV-448"box1QV-660"box136 boxQA-336"box1QA-660"box1QA-448"box1QA-448"box1QA-336"box1SEE PD-2 FOR TYP. PLANTINGENLARGEMENTQA-336"box2RRSEE NOTE #1A336"box1A448"box1A224"box1A336"box4A448"box2QA-336"box1ZONE F - 11/12/POOL(14) Buddleja x 'Blue Chip'(8) Dodonaea viscosa(15) Leonotis leonurus(6) Leucadendron x 'Safari Sunset'(15) Phlomis fruticosa(25) Westringia fruticosa 'WES03'MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYQA-336"box1MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)ZONE C - SCREENING SHADE(2) Ceanothus x 'Dark Star'(8) Heteromeles arbutifolia(3) Prunus laurocerasusPROJECT:SHEET TITLE:PP-4SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN-------XXXXXXXDFKA1" = 50'-0"KA241803-28-25MATCHLINE PP-3MATCHLINE PP-5SEE PP-2 FOR LEGENDSAND SCHEDULES, PD-1 FORPLANTING DETAILS/NOTESSEE PD-2 FOR LANDSCAPETYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 509 EX 3-5' TALL RETAINING WALL BLOCKCONCRETE V-DITCHQV-660"box1QV-448"box2QV-448"box1A336"box1A448"box1QA-448"box1PR-660"box1PR-448"box3A448"box2QV-336"box1QA-336"box1PR-448"box3QA-336"box1QA-224"box1QA-448"box1QA-336"box1QA-448"box1PR-448"box2PR-660"box1QA-660"box1QV-336"box1QV-448"box1ZONE I - SW CORNER SCREENING(11) Arbutus unedo(26) Ceanothus x 'Dark Star'(26) Phlomis purpurea(27) Rhus integrifolia(48) Westringia fruticosa 'WES03'ZONE H - 12 UNDERSTORY(89) Grevillea rosmarinifolia(44) Heteromeles arbutifolia(66) Rhus integrifoliaCIS5 gal17ZONE K - 17 RIGHT SIDE(24) Buddleja x 'Blue Chip'(9) Rhus integrifolia(84) Westringia fruticosa 'WES03'LAKEA336"box1ZONE J - 17T/MAINT(16) Ceanothus x 'Dark Star'(17) Ceanothus x 'Joyce Coulter'(27) Frangula californicaQA-660"box1QA-660"box1QA-336"box1QA-448"box1A336"box1A224"box1QV-448"box2SEE PD-2 FOR TYP. PLANTINGENLARGEMENTEX PATHMAINTENANCEGATESEE NOTE #1MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYQA-448"box1SEE NOTE #1SEE NOTE #1MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)PROJECT:SHEET TITLE:PP-5SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEET BOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN-------XXXXXXXDFKA1" = 50'-0"KA241803-28-25MATCHLINE PP-4SEE PP-2 FOR LEGENDSAND SCHEDULES, PD-1 FORPLANTING DETAILS/NOTESSEE PD-2 FOR LANDSCAPETYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 510 6"Page 511 EX TREEWOOD MULCHNEW CANOPYTREE MAY OCCURMEDIUM SHRUBLARGE SHRUBSMALL ACCENT SHRUBSNEW CANOPYTREE MAY OCCURACCESS ROAD / CART ROADTEE BOXTURFTURFNEW CANOPYTREE MAY OCCUREX 5' TALL C H A I N L I N K F E N C E ( B L A C K )HOMEOWNERLOT - FENCELINEDOES NOT NEED100% SCREENINGHOMEOWNERLOT -FENCELINEAND LOTNEEDSSCREENINGAT 5' TALLHOMEOWNER VIEWHOMEOWNER VIEWINFORMAL SCREENING TOSOFTEN HOMES AND FENCELINESMAINTAIN EXISTINGHOMEOWNER VIEWSTO GOLFEX 5' TALL CHAINLINK FENCE - NO HEDGELARGE SHRUBSMEDIUM SHRUBSEX TREEEX TREECART PATHCART PATHEX TREE CANOPYTURFPLEXISTINGMEADOW/MULCHGROUNDPLANEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCELARGE SHRUBSMEDIUM SHRUBSNEW CANOPY TREEEX TREEWOOD MULCHMEDIUM SHRUBLARGE SHRUBSMALL ACCENT SHRUBTEE BOXTEE BOXCART PATHHOMEOWNERLOT - FENCELINEAND LOT NEEDSSCREENING AT 5'TALLHOMEOWNERLOT - CURRENTLYHAS NO VIEW TOGOLFEXISTING 8' TALL HEDGETURFPLPROJECT:SHEET TITLE:PD-2SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING TYPICALS-------XXXXXXXDFKA1" = 20'-0"KA241803-28-25SOFTENING / PARTIAL SCREENING OF RESIDENTIAL(RIGHT OF HOLE 12)LOW -MEDIUM DENSITY TO SCREEN ROAD(BTWN HOLES 1 & 5)FULL SCREENING OF RESIDENTIALFENCELINE - MEDIUM DENSITY(RIGHT OF HOLE 18)THESE ENLARGEMENTS ARE SHOWN TOILLUSTRATE THE DENSITIES OF SHRUBPLANTING IN OUR PLANTING ZONES.CONTRACTOR IS NOT TO USE THESEENLARGEMENTS FOR TAKE-OFF PURPOSES.FOLLOW THE QUANTITIES ON THE PP- SHEETS.17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 512 375380385350350355360365370375380350355360365370370365375375375375380380380380380380375375375370370 365365 355360380380385385390390390395395395400400400400395395395395370370370370365365365365360360360360355355355350345330370380375370365360 355 350 3453403353606967 395393939393393939393333939393933333939393939393939393939393953703703703703703703703703703703703707070707037037037037037037037037037070703903390390375375380380385858585858538338585858537537537575370373733373703803808038038038038038038380380380380383803803803803803803838383380380380380808080808080803838380383838383838404040040440404040404040404040404040440404040404040404044444444400400404004912131415161710181112893503350350503603363603606033350350350350333355553553536036036036336565365365364004004003653653633633603603606060606060606060603603603603606060360603606060360360366036036035353553535353535353535353535353353553553503503503505034534345453303303303453453453453453403403403403403403403353353353353354000000400400004004040040040040404004004004004040404040370370373703737037037037037373737370363636363636536365365365363636365363653653653653657575370370370370370370375370370370370707070707070707070707070370370370370370370370370373775753753707037037360603553553603653653603636363660336333603607537373703737033333365656565653653653653653653653653653636363636363636363637037037373737373737337373333333375603703737370373737333703753753803803838080383838038383838038383803808038038038038038038038038038038038038038080803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803803838383838383838383838383838383838333703370395339539539539539539539539540400404044040380388000000000000000000000000000003838383838383838400400400004004004004004004004004004009595000000400400404404040404004004004004004004004000000004004004004004004004004040404040404040365365365656536537037037033703703737707033737373737373737037070703707036536536536363733337380380808080808080808080808080808080808080380380380375375375375373737537575757575375380380383838383838383838383838383833333333380380380375375375375375375375375373737375370370370370370370 365365365365365363636365365 355355380380336036036360360360 3753737373737537575373333333337333737373636355355360360338585383903939393990909039393939393939393939393939393939393339393903939393953959575753803838038383903939039090395395395395959595393953953939539539393995395395395383853838383838383838538383838383838383838385383838383838385375375373737373333838383838383838383838383903903903903903953953953953939953953959595959595959595959539539539539539539539539539539539539539539539393939393939393939393939393938038380380808080380380380380383838333703703703703703703703703703703703703703703703703703703703703703703703737370370370370373737037373703703737373737373737 753753753753753753753753753753753737373737373803803803803803803803803803803803803808080808080383838383838383880803803803803803803803803803838383838383959595953956969693503503503503553535535355555555567676969696969696969505035035035035035035033355353553553533535353535035353503503503535035350350350350350350350350350350350350350350350350350350350350350350350350350350503503503503505035050350350350505050503505050505050505050505050505050505050505050505050505050505050503333333353353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353535353503503503535353535035035035035035350353535353535353535350350350353503503503503503503535353535035350350350350350350350350350350350350350353535353503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503503505050505050503505050350503503503503503503503503503503503503503503503503503503503503505050505050350505050505050505050505050505050503505035050350350350350350350350505050503503505050505050505050505050505050505050505050503503503505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050505050EX 5' TALL CHAINLINK FENCEEX 6' TALL WOOD FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCE EX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCE (BLACK)EX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCE EX 5' TALL CHAINL I N K FENCE (BLACK )ELECEX 5' TALL W O O D F E N C E EX 5' TALL CHA I N L I N K F E N C E EX 5' TALL CHAINLIN K F E N C E EX 5' TALL CH A I N L I N K F E N C E ( B L A C K ) EX 5' TALL RETAINING WALL BLOCK WITH 5' TALL WROUGHT IRON FENCE EX 5' TALL WR O U G H T I R O N F E N C E EX 5' TALL W R O U G H T I R O N F E N C E EX 5' TALL WR O U G H T I R O N F E N C E EX 6' TALL WOOD FENCETING B R I D G E STINGBRRIDGSTINSTINSTIN EXISTI N EXISEXEXEXLakeFill LakeFillLakeFillLake#1653.045.04:145464748495051524:145464748 495051524:15251504948474645VVVVlc 4:146.545.544.543.542.541.540.539.53:1Lake#1147.539.539.540.541.542.543.544.545.546.5 3:139.540.541.542.543.544.545.546.53:139.540.541.542.543.544.545.546.53:146.545.544.543.542.541.540.539.53:1 46.545.544.543.542.541.540.539.53:1VVSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK0.1Lake System Site Plan, Notes, etc0'100'200'300'NORTHScale: 1" = 100'LAKE SYSTEM GENERAL NOTES:1. THESE DRAWINGS ARE INTENDED FOR LAKE CONSTRUCTION USE ONLY. SEE DRAWINGS BY RESPECTIVEDESIGNERS FOR OTHER ASPECTS OF CONSTRUCTION.2. IT IS THE INTENT OF THESE DRAWINGS AND THIS DESIGN THAT THE WORK REPRESENTED HERE BE COMPLETEDBY A LICENSED CONTRACTOR WITH EXPERIENCE AND QUALIFICATIONS SPECIFIC TO THIS UNIQUE WORK. THELAKE CONTRACTORS EXPERIENCE AND QUALIFICATIONS SHALL INCLUDE, AT A MINIMUM, THE SUCCESSFULCOMPLETION OF AT LEAST (5) PROJECTS EQUIVALENT IN SCOPE COMPLETED WITHIN THE LAST (2) YEARS ASDETERMINED BY THE OWNER OR HIS REPRESENTATIVE. THE LAKE CONTRACTOR SHALL SUBMIT, WITH HIS BID, ALIST OF QUALIFYING COMPLETED PROJECTS INCLUDING THE NAMES, ADDRESSES, AND PHONE NUMBERS FOR THEOWNER (OR HIS REPRESENTATIVE) AND THE LAKE ENGINEER. THE PROJECT OWNER SHALL MAKE THE FINALDETERMINATION AS TO THE QUALIFYING EXPERIENCE OF THE LAKE CONTRACTOR. FURTHER, IT IS THE INTENT OFTHIS DESIGN TO CONVEY A COMPLETE AND WORKABLE LAKE SYSTEM. THE LAKE CONTRACTORS PRICING SHALLINCLUDE ALL MATERIALS, EQUIPMENT, ACCESSORIES, ETC. REQUIRED TO PRODUCE A COMPLETE AND WORKABLELAKE SYSTEM TO INDUSTRY STANDARDS.3. THE LAKE CONTRACTOR SHALL VERIFY ALL DIMENSIONS, ELEVATIONS, AND CONDITIONS PRIOR TO STARTINGWORK. THE LAKE CONTRACTOR SHALL NOTIFY THE OWNER'S REPRESENTATIVE OF ANY DISCREPANCY IN THEDRAWINGS OR SITE CONDITIONS SO THAT PROPER CLARIFICATIONS CAN BE MADE BEFORE CONSTRUCTIONBEGINS.4. IN ADDITION TO EXAMINING THESE PLANS, THE LAKE CONTRACTOR IS EXPECTED TO HAVE VISITED ANDINSPECTED THE SITE IN ORDER TO DETERMINE THE GRADES AND TRUE CONDITIONS UNDER WHICH THE WORK ISTO BE PERFORMED. SHOULD ANY OMISSIONS, CONFLICTS, OR AMBIGUITIES IN THE DRAWINGS BE DISCOVEREDDURING THE EXAMINATION OF THE DRAWINGS OR UPON VISITING THE SITE, THE OWNER'S REPRESENTATIVESHALL BE NOTIFIED IMMEDIATELY.5. 30 MIL LLDPE-R LAKE MEMBRANE LINER: THE CONTRACTOR SHALL FURNISH AND INSTALL SUFFICIENT LININGMATERIAL TO COVER ALL LINED AREAS SHOWN ON THE PLANS INCLUDING PANEL OVERLAPS AT FIELD SEAMS ANDIN DEPRESSIONS. THE LINING MATERIAL SHALL BE LINEAR LOW DENSITY POLYETHYLENE - REINFORCED (LLDPE-R)MEMBRANE AND SHALL BE MANUFACTURED BY THE CALENDARING PROCESS. THE LINING MATERIAL SHALL BEUNIFORM IN COLOR, THICKNESS, SIZE, AND SURFACE TEXTURE. LINING INSTALLATION SHALL NOT BEGIN UNTIL APROPER BASE HAS BEEN PREPARED TO ACCEPT THE MEMBRANE LINING. BASE MATERIAL SHALL BE FREE FROMANGULAR ROCKS, ROOTS, GRASS, AND VEGETATION. FOREIGN MATERIALS AND PROTRUSIONS SHALL BEREMOVED AND ALL CRACKS AND VOIDS SHALL BE FILLED AND THE SURFACE MADE LEVEL OR UNIFORMLY SLOPINGAS INDICATED ON THESE DRAWINGS. THE PREPARED SURFACE SHALL BE FREE OF LOOSE EARTH, ROCKS,RUBBLE, AND OTHER FOREIGN MATTER. THE SUBGRADE SHALL BE UNIFORMLY COMPACTED TO ENSURE AGAINSTSETTLEMENT. THE SURFACE ON WHICH THE LINING IS TO BE PLACED SHALL BE MAINTAINED IN A FIRM, CLEAN,DRY, AND SMOOTH CONDITION DURING LINING INSTALLATION.6. 300mm (12") SELECT SOIL COVER: A COVER OF NATIVE SELECT SOILS 300mm (12") MINIMUM THICKNESS SHALL BEPLACED OVER THE LINER IN THOSE AREAS SHOWN ON THESE PLANS. THE SELECT SOIL COVER SHALL BESTOCKPILED WHERE INDICATED ON THE LAKE EDGE DETAIL ON IN AREAS APPROVED BY THE OWNER'SREPRESENTATIVE. THE SOIL SHALL BE PLACED OVER THE LINER IN SUCH A MANNER AS TO ENSURE THATPUNCTURES SHALL NOT OCCUR. IF EQUIPMENT DOES PUNCTURE THE LINER MATERIAL, THE COVER INSTALLATIONSHALL STOP AND REPAIRS TO THE LINER SHALL BE MADE IN ACCORDANCE WITH THE LINER SUPPLIER'SREQUIREMENTS. THE SOIL COVER MATERIAL SHALL BE FREE OF ANGULAR ROCKS, ROOTS, GRASS, ANDVEGETATION. FOREIGN MATERIALS SHALL BE REMOVED FROM THE SOIL COVER MATERIAL PRIOR TOINSTALLATION OF THE MEMBRANE LINER. SEE MANUFACTURER'S GUIDE SPECIFICATIONS FOR MOREINFORMATION.7. CONCRETE VENEER COVER (shown as shaded on the plan views): A WIRE REINFORCED CONCRETE VENEER COVERSHALL BE INSTALLED OVER THE MEMBRANE LINER BY THE LAKE CONTRACTOR WHERE SHOWN ON THESE PLANS.THE CONCRETE VENEER SHALL CONSIST OF A MINIMUM 6 SACK MIX TYPE 1 OR 2 PORTLAND CEMENT WITH AMAXIMUM AGGREGATE SIZE OF 10mm (3/8"). THE CONCRETE SHALL OBTAIN A 28-DAY COMPRESSIVE STRENGTHOF 2500 P.S.I. WHEN PREPARED IN ACCORDANCE WITH A.S.T.M. C31 TEST METHOD 231. CONCRETE FAILING TOMEET THIS SPECIFICATION SHALL BE REMOVED AND REPLACED. A 25mm x 25mm x 20 GAUGE (1" x 1" x 20 ga.)OCTAGONAL WIRE MESH SHALL BE PLACED OVER THE MEMBRANE LINER IN ALL AREAS TO RECEIVE A CONCRETEVENEER. THE WIRE SHALL BE LAID IN A CONTINUOUS LAYER WITH ADJACENT EDGES OVERLAPPING 50mm (2")MINIMUM AND SECURED TO ONE ANOTHER BY THE USE OF HOG RINGS OR OTHER APPROPRIATE CLIPS WHICHCANNOT PUNCTURE THE LINER. THE CONCRETE SHALL BE PLACED OVER THE WIRE. ALL WIRE SHALL BECOVERED WITH CONCRETE SUCH THAT NO WIRE IS VISIBLE ON THE SURFACE OR EDGE OF THE CONCRETEEXCEPT WHERE INDICATED ON THESE PLANS. THE CONCRETE SHALL BE ROUGH BROOM FINISHED AND WATEROR MEMBRANE CURED TO PREVENT EXCESSIVE CRACKING OR CHECKING. NO EXPANSION JOINTS WILL BEREQUIRED. THE CONCRETE VENEER IS EXPECTED TO CRACK DURING AND AFTER CURING. CRACKS 6mm (1/4")AND LARGER SHALL BE CAULKED.8. DECORATIVE SHORELINE TREATMENT: AN ARTIFICIAL SHORELINE SHALL BE CONSTRUCTED THAT HAS THEAPPEARANCE OF A NATURAL LAKE SHORELINE EDGE AROUND THE LAKE PERIMETER AS INDICATED ON THESEPLANS. PRIOR TO GENERAL SHORELINE INSTALLATION, THE LAKE CONTRACTOR SHALL INSTALL A 3m (10') LONGSHORELINE TEST SECTION FOR APPROVAL BY THE OWNER'S REPRESENTATIVE OF TEXTURE AND COLOR. THEARTISTIC RESULT OF THE SHORELINE TREATMENT SHALL REST WITH THE LAKE CONTRACTOR'S ABILITY TOPERFORM THIS WORK TO THE SATISFACTION OF THE OWNER'S REPRESENTATIVE AND IN ACCORDANCE WITH THEPRE-APPROVED TEST SECTION.9. CONSTRUCTION ACCESS: THE LAKE CONTRACTOR AND THE OWNER'S REPRESENTATIVE SHALL REVIEW THE SITEPRIOR TO CONSTRUCTION TO ESTABLISH AN ACCESS ROUTE IN AND OUT OF THE LAKE CONSTRUCTION AREA. THECONTRACTOR SHALL PROVIDE STAKES OUTLINING THE ACCESS ROUTE AND SHALL AT ALL TIMES KEEPCONSTRUCTION EQUIPMENT, PERSONNEL, AND VEHICLES WITHIN THE LIMITS OF THIS ROUTE. REPAIRS TO THESEFACILITIES WITHIN THE LIMITS OF THE CONSTRUCTION ACCESS ROUTE SHALL BE MADE BY THE OWNER'SREPRESENTATIVE. ALL REPAIRS OUTSIDE THESE LIMITS SHALL BE THE RESPONSIBILITY OF THE LAKECONTRACTOR.10. LAKE GRADING:A. ALL WORK SHALL CONFORM TO THE LATEST ADOPTED EDITION OF THE INTERNATIONAL BUILDING CODE (I.B.C.)AND ALL LOCAL CODES AND ORDINANCES. AN EFFORT HAS BEEN MADE TO DEFINE THE LOCATION OFUNDERGROUND FACILITIES WITHIN THE WORK AREA (THESE PLANS AND THE PLANS OF OTHER DISCIPLINES ONTHIS PROJECT). THE LAKE CONTRACTOR SHALL ASSUME SOLE AND COMPLETE RESPONSIBILITY FOR LOCATION,OR HAVING LOCATED, ALL UNDERGROUND UTILITIES AND RELATED FACILITIES AND FOR PROTECTING SAMEDURING THE COURSE OF CONSTRUCTION.B. ALL AREAS TO RECEIVE FILL SHALL BE CLEARED OF ALL BRUSH AND OTHER OBJECTIONABLE DEBRIS,INCLUDING EXISTING SOD AND OTHER ORGANIC MATERIALS, SCARIFIED TO A DEPTH OF 300mm (12") ANDWATERED AND COMPACTED TO 85% RELATIVE DENSITY IN LAKE AREAS PER THE REQUIREMENTS OF A.S.T.M.DESIGNATION D-1557-65T, OR AS APPROVED BY THE LAKE ENGINEER. THE FILL MATERIAL SHALL BE PLACED INCOMPACTED LAYERS AS SHOWN ON THE LAKE EDGE DETAILS AND FILLED AND COMPACTED AT OPTIMUMMOISTURE CONTENT BY AN APPROVED METHOD. THIS PROCEDURE SHALL APPLY ONLY FOR THE LAKE SHORELINEFILLS ON THIS PROJECT AND IS NOT INTENDED FOR BUILDING, BRIDGES, OR OTHER STRUCTURES.C. ALL UNSUITABLE SOIL, ORGANIC MATERIALS, ASPHALT, CONCRETE RUBBISH, DEBRIS, ETC. RESULTING FROMGRADING OR DEMOLITION OPERATIONS SHALL BE REMOVED FROM THE JOB SITE, TRANSPORTED TO A SUITABLELOCATION AND DISPOSED OF IN ACCORDANCE WITH APPLICABLE REGULATIONS.D. THE LAKE CONTRACTOR SHALL EMPLOY ALL LABOR, EQUIPMENT, AND METHODS REQUIRED TO PREVENT HISOPERATIONS FROM PRODUCING DUST IN AMOUNTS DAMAGING TO PROPERTY, CULTIVATED VEGETATION, ANDDOMESTIC ANIMALS OR CAUSING A NUISANCE TO PERSONS OCCUPYING BUILDINGS IN THE VICINITY OF THEJOBSITE. THE LAKE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY DAMAGE CAUSED BY THE DUST RESULTINGFROM HIS OPERATIONS. DUST ABATEMENT MEASURES SHALL BE CONTINUED UNTIL AFTER THE COMPLETION OFTHE LAKE CONTRACTOR'S WORK.E. THE LAKE CONTRACTOR SHALL ASSUME SOLE AND COMPLETE RESPONSIBILITY FOR PROTECTION OF PUBLICAND PRIVATE PROPERTY ADJACENT TO THE SITE AND THAT HE SHALL, AT HIS EXPENSE, REPAIR OR REPLACE TOORIGINAL CONDITION, ALL EXISTING IMPROVEMENTS WITHIN OR REMOVED AS A RESULT OF HIS OPERATIONS.F. THE LAKE CONTRACTOR SHALL MAINTAIN CURRENT, COMPLETE, AND ACCURATE RECORD OF ALL CHANGESWHICH DEVIATE FROM THE CONSTRUCTION AS PROPOSED BY THESE PLANS FOR THE PURPOSE OF PROVIDINGTHE LAKE ENGINEER WITH A BASIS FOR RECORD DRAWINGS. NO CHANGES SHALL BE MADE WITHOUT PRIORAPPROVAL OF THE OWNER'S REPRESENTATIVE AND THE LAKE ENGINEER. IN THE EVENT THAT THE LAKECONTRACTOR NOTICES IRREGULARITIES IN THE LINE OR GRADE, HE SHALL BRING IT TO THE IMMEDIATEATTENTION OF THE LAKE ENGINEER AND THE OWNER'S REPRESENTATIVE FOR A PROPER RESOLUTION. IF HEFAILS TO DO SO, THE LAKE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY ERROR IN THE GRADE AND THENECESSARY RECONSTRUCTION TO CORRECT SUCH ERROR.G. THE LAKE CONTRACTOR AGREES THAT, IN ACCORDANCE WITH GENERALLY ACCEPTED CONSTRUCTIONPRACTICES, THE LAKE CONTRACTOR SHALL BE REQUIRED TO ASSUME SOLE AND COMPLETE RESPONSIBILITY FORTHE CONDITION OF THE JOB SITE LAKE AREA DURING THE COURSE OF CONSTRUCTION FOR THE PROJECTINCLUDING THE SAFETY OF ALL PERSONS AND PROPERTY AND THAT THIS REQUIREMENT SHALL BE MADE TOAPPLY CONTINUOUSLY AND NOT BE LIMITED TO NORMAL WORKING HOURS.H. NEITHER THE OWNER, NOR THE LAKE ENGINEER, WILL ENFORCE SAFETY MEASURES FOR REGULATIONS ASTHEY PERTAIN TO THE LAKE CONTRACTOR, THE LAKE CONTRACTOR SHALL DESIGN, CONSTRUCT AND MAINTAINALL SAFETY DEVICES, INCLUDING SHORING AND SHALL BE SOLELY RESPONSIBLE FOR CONFORMING TO ALL LOCALSTATE AND FEDERAL SAFETY AND HEALTH STANDARDS, LAWS, AND REGULATIONS. THE LAKE CONTRACTORSHALL PROVIDE TO THE OWNER, PRIOR TO THE START OF WORK, WORKER'S COMPENSATION INSURANCE,PRODUCTS AND COMPLETED OPERATIONS AND COMPREHENSIVE LIABILITY INSURANCE CERTIFICATES.11. LAKE RECIRCULATION SYSTEM AND AERATION SYSTEM PIPING:ALL PIPE SHOWN ON THESE PLANS SHALL BE P.V.C. (POLYVINYL CHLORIDE) OR HDPE (HIGH DENSITYPOLYETHYLENE) PIPE UNLESS OTHERWISE NOTED AND SHALL CONFORM TO THE FOLLOWING SCHEDULE:PVC:HDPE:PIPES 100mm (4") dia. AND SMALLER: SCHEDULE 40 (I.P.S.) DR 11PIPES 150mm (6") dia. AND 200mm (8") dia: CLASS 160 (I.P.S.) DR 11PIPES 250mm (10") dia. TO 900mm (36") dia: 100 psi (P.I.P.) DR 13.5Important!! IF HDPE IS USED ENSURE THAT THE INSIDE DIAMETER OF THE PIPE MATCHES WHAT IS SHOWN ONTHE PLAN.12. ALL LAKE RECIRCULATION SYSTEM PIPING SHALL BE INSTALLED SO THE FLOW IS LEVEL OR UPHILL TO PREVENTAIR TRAPS AND SHALL BE A MINIMUM 900mm (3'-0") COVER OUTSIDE THE LAKE LIMITS AND 300mm (1'-0") MINIMUMCOVER WITHIN LAKE LIMITS UNLESS OTHERWISE NOTED ON THESE PLANS. THE LAKE CONTRACTOR SHALLSUBMIT MANUFACTURER'S PRODUCT DATA SHEETS WHICH INDICATE PIPE WALL THICKNESS AND JOINT TYPES TOTHE LAKE ENGINEER FOR APPROVAL PRIOR TO ORDERING PIPE MATERIAL.Lake 16 Data:WATER SURFACE AREA (SF): 23,630SHORELINE LENGTH (LF): 811LAKE VOLUME (GALLONS): 723,340(2.22 ac-ft)Lake 11 Data:WATER SURFACE AREA (SF): 36,620SHORELINE LENGTH (LF): 1,060LAKE VOLUME (GALLONS): 1,564,000(4.80 ac-ft)La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CANOT FORCONSTRUCTION03-28-202503-28-2025Page 513 37537036536536036035535535034515UGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL CHAINLINK FENCE (BLACK) AINLINK FE N C E Matchline - see sheetMatchline - see sheetLK3.1ALAIDBACKSHORELK3.1ALAIDBACKSHORELK3.1ALAIDBACKSHORELK3.1ALAIDBACKSHORELake#1653.045.04:145 46 47 48 49 50 51 52 4:1 45464748495051524:15251504948474645LK3.2APLANTERSHORELK3.2APLANTERSHORELK3.2APLANTERSHORELK3.2APLANTERSHORELK3.2APLANTERSHORE(BIOBOOST)(BIOBOOST)(BIOBOOST)(BIOBOOST)LK3.4ATROUGH6'-0"6'-0"10'-0"10'-0"LK3.4D50'CUT-OFFWALLBOULDERPOCKET ASSHOWN PERDETAIL(TYPICAL WHEREROCK IS SHOWNAT SHORELINE)BLK3.2BOULDERPOCKET ASSHOWN PERDETAIL(TYPICAL WHEREROCK IS SHOWNAT SHORELINE)BLK3.2SEAL RECIRC. INTAKEPIPE TO LAKE LINERAS SHOWN PERDETAILLK6.1A346.50INV. EL.INTAKE PIPEINTAKE PIPE SCREENPER DETAILLK6.1BVVVVLK3.4ATROUGH(2) 1"2"dia. AERATION PIPE18"dia. INTAKE PIPE8"dia. TRANSFER PIPE2"dia. AERATION PIPE(2) 1"8"dia. TRANSFER PIPEAeration SystemCabinets:PROVIDE (2) AERATION SYSTEMCABINET, EACH WITH (2)COMPRESSORS PER DETAILTHE CABINETS SHALL BEINSTALLED ON THE PUMPSTATION SLABLK4.1A / BTRANSFER PUMP STATIONAS SHOWN PER DETAILT.O. WET WELL EL. 360.20INTK PIPE I.E. 345.50WELL F.F.E. 343.75LK5.1ABLK2.1ALK2.1lc 2-1/2" di a. LAKE FI L L POINT OFCONNECTIONTO IRRIGATIONMAIN LINEMECHANICAL LEVELCONTROL AS SHOWNPER DETAILLK3.6BLK3.4ATROUGH6'-0"6'-0"SEAL LINER TOOVERFLOWSTRUCTURE ASSHOWN PER DETAIL- SEE CIVIL PLANSFOR MORE INFOLK3.3ALK3.4ATROUGH6'-0"6'-0"NEW WELL FILL TRANSFER PIPE BY OTHERSNEW WELL FILL TRANSFER PIPE BY OTHERSNEW WELL F I L L T R A N S F E R PIPE BY OTH E R S NOTE:FOR TYPICAL LAKEFILL REQUIREMENTSSEE DETAILWHEREOCCURS IN THEFIELDLK3.6ALK3.3ANOTE:WEST SIDE OF LAKEHAS (2) FAIRWAY /GREEN DRAIN PIPES- VERIFY PIPEQUANTITY ANDLOCATIONS IN THEFIELD - CONNECT TOEXISTING DRAIN PIPE6" ABOVE THE FINISHFREEBOARD OF THELAKE AND RUN SOLIDWALL PIPE WITHSOLVENT WELDFITTINGS THRU LAKELINER WITH PIPEBOOT AS SHOWN PERRUN WELL FILL OVERSHORELINE AS SHOWNPER DETAILCONCEALWITH ROCKLK3.4BRUN WELL FILL OVERSHORELINE AS SHOWNPER DETAILCONCEALLK3.4BNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.1Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2BLa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 514 37538038038538539012EX 5 EX 5' TAL L C H A I N L I N K F E N C E ( B L A C K )Matchline - see sheetMatchline - see sheet8"dia. TRANSFER PIPEMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheet8"dia. TRANSFER PIPENEW WELL FILL TRANSFER PIPE BY OTHERSNEW WELL FILL TRANSFER PIPE BY OTHERSNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.2Lake System Plan ViewLEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2B0'20'30'40'NORTHScale: 1" = 20'La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 515 3753703803851212EX 5' TAL L C H A I N L I N K F E N C E ( B L A C Matchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheet8"dia. TRANSFER PIPE8"dia. TRA N S F E R P I P E 8"dia. TRAN S F E R P I P E NEW WELL F I L L T R A N S F E R P I P E B Y O T H E R S NEW WELL FILL TRANSFER PIPE BY OTHERSNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.3Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2BLa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 516 350380380380375370 365365 355360360 EX 5' TALL RE T A I N I N G W A L L B L O C K W I T H 5 ' T A L L W R O U G H T I R O N F E N C E EX 5' TALL W R O U G H T I R O N F E N C E EX 5' TALL W R O U G H T I R O N F E N C E X 5' TALL W R O U G H T I R O N F E N C E Matchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheet8"dia. TRAN S F E R P I P E 8"dia. TRA N S F E R P I P ENEW WELL FILL TRANSFER PIPE BY OTHERSNEW WELL F I L L T R A N S F E R P I P E B Y O T H E R S NOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.4Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2BLa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 517 350350355360365370375350375380380380696710119ELECEX 5' TALL W RTING BRI DG EGBRIDGTING BRI DG ETINSTINSTINEXISTINEXIEXIEXIEXILakeFillLake FillLakeFillMatchline - see sheetMatchline - see sheetLK3.5B2PLANTERSHORELK3.2ALK3.1ALAIDBACKSHOREPLANTERATEXISTINGSHORELINELK3.5B1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5B2PLANTERATEXISTINGSHORELINELK3.5B1LK3.5B2PLANTERATEXISTINGSHORELINELK3.5B1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5B2PLANTERATEXISTINGSHORELINELK3.5B1LK3.1ALAIDBACKSHORELK3.2APLANTERSHORELK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1PLANTERATEXISTINGSHORELINELK3.5B1LK3.5B2LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1OTMMMMMOMTMMMBOULDERPOCKET ASSHOWN PERDETAIL(TYPICAL WHEREROCK IS SHOWNAT SHORELINE)BLK3.2EXISTING OVERFLOWTO REMAIN AS IS - DONOT DISTURBLK6.1PROVIDE 36" WIDESECTION OFEXISTING LINER TOATTACH NEW LINERAS SHOWN PERDETAILCCUT EXISTINGRETAINING WALL ANDFOOTING TO REVEALEXISTING LINER TOSEAM TO - DO NOTDAMAGE EXISTINGLINEREXISTING STORM FLOW ENTRY STRUCTURETO REMAIN AS IS - DO NOT DISTURBEXISTING IRRIGATIONSTATION TO REMAIN -INSTALL ADDITIONALAERATION CABINETINSIDE BUILDING TOPROVIDE ADDITIONALAERATIONAeration SystemCabinets:PROVIDE (1) AERATION SYSTEMCABINET, EACH WITH (2)COMPRESSORS PER DETAILTHE CABINETS SHALL BEINSTALLED ON THE INSIDEEXISTING IRRIGATION BUILDINGNEXT TO EXISTING AERATIONCABINET - FIELD LOCATEEXISTING AERATION VALVESAND RUN NEW 2"dia. AERATIONPIPE TO EXISTING VALVELOCATIONLK4.1A / BLK3.6PROVIDE 36" WIDESECTION OFEXISTING LINER TOATTACH NEW LINERAS SHOWN PERDETAILBCUT EXISTINGRETAINING WALL ANDFOOTING TO REVEALEXISTING LINER TOSEAM TO - DO NOTDAMAGE EXISTINGLINER4:146.545.544.543.542.541.540.539.53:1Lake#1147.539.5LK6.1CSEALTOEXISTINGLINER(BIOBOOST)(BIOBOOST)(BIOBOOST)(BIOBOOST)(EXISTING)(VERIFY)(EXISTING)(VERIFY)(EXISTING)(VERIFY)(NEW)39.5 40.5 41.5 42.5 43.5 44.5 45.5 46.5 3:139.540.541.542.543.544.545.546.53:139.540.541.542.543.544.545.546.53:146.545.544.543.542.541.540.539.53:1 46.545.544.543.542.541.540.539.53:1EXISTINGIRRIGATIONINTAKE PIPEVV(2)1"NOTE:WEST SIDE OF LAKEHAS (3) DISCHARGEPIPES WITHISOLATION VALVES INEXISTINGWATERFALLSTRUCTURES -VERIFY PIPELOCATIONS IN THEFIELD AND DEMOEXISTINGWATERFALLSTRUCTURES - RUNPIPE OVER LINERWITH 6" AIR GAP ANDCONCEAL WITH ROCK/ PLANTING2"8"dia. TRA N S F E R P I P E6'-0"6'-0"LK3.4ATROUGH6'-0"6'-0"LK3.4ATROUGHLK3.5B2PLANTERATEXISTINGSHORELINELK3.5B16'-0"6'-0"LK3.4ATROUGH6'-0"6'-0"LK3.4ATROUGHEXISTING WELL FILL (FIELD VERIFY LINESIZE)EXISTING WELL FILL (FIELD VERIFY LINESIZE)NEW WELL FILL TRANSFER PIPE BY OTHERSRSNOTE:FOR TYPICAL LAKEFILL REQUIREMENTSSEE DETAILWHEREOCCURS IN THEFIELDLK3.6AEXISTING BRIDGE TOREMAIN - DO NOT DISTURBPLANTERATEXISTINGSHORELINELK3.5B1LK3.5B2LK3.3ANOTE:WEST SIDE OF LAKEHAS (3) FAIRWAY /GREEN DRAIN PIPES- VERIFY PIPEQUANTITY ANDLOCATIONS IN THEFIELD - CONNECT TOEXISTING DRAIN PIPE6" ABOVE THE FINISHFREEBOARD OF THELAKE AND RUN SOLIDWALL PIPE WITHSOLVENT WELDFITTINGS THRU LAKELINER WITH PIPEBOOT AS SHOWN PERSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.5Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2BLa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 518 +5+0+25+20+15+10-5-10-15+25+20+15+10+5+0-5-10-15-20-20LAKE - WIDTH VARIES PER PLAN4 (MIN.)1DEPTHPER PLAN4 (MIN.)1LAKE SHORELINESHOWN ON PLANCONCRETE SHELF(WIDTH VARIES PERSHORE DETAIL)LAKE SHORELINESHOWN ON PLANCONCRETE SHELF(WIDTH VARIES PERSHORE DETAIL)A"LAID BACK" SHORELINETREATMENT PER DETAIL.LK3.1.12" THICK SELECT SOIL LINERCOVER PER GENERAL NOTESLAKE GEOMEMBRANE LINERPER GENERAL NOTESCAREFULLY PREPARED LINERSUBGRADE PER GENERAL NOTES- TYPICAL THRU-OUT LIMITS OFLAKE GEOMEMBRANE LINERA"LAID BACK" SHORELINETREATMENT PER DETAIL.LK3.1LAKEWATERSURFACEEL. PERPLANLAKELINERELEVATIONPER PLANLAKEWATERSURFACEEL. PERPLANLAKELINERELEVATIONPERPLANALTERNATE BID ITEM8oz GEOTEXTILE FABRIC BENEATHGEOMEMBRANE LINER PER GENERALNOTES (TYPICAL) SHOWN AS DASHED LINEALTERNATE BID ITEM6" THICK (MINIMUM) APPROVED PLATINGMATERIAL BY GRADING CONTRACTOR - SEEGENERAL NOTES FOR ALLOWABLE SOIL TO BEUSED BENEATH GEOMEMBRANE LINER+5+0+25+20+15+10-5-10-15+25+20+15+10+5+0-5-10-15LAKE WATERSURFACE EL.PER PLANLAKE LINERELEVATIONPER PLANLAKE WATERSURFACE EL.PER PLANLAKE LINERELEVATIONPER PLAN-20-20LAKE - WIDTH VARIES PER PLAN4 (MIN.)1DEPTHPER PLAN4 (MIN.)1LAKE SHORELINESHOWN ON PLANPLANTER POCKET(WIDTH VARIES PERSHORE DETAIL)LAKE SHORELINESHOWN ON PLAN.12" THICK SELECT SOIL LINER COVER PERGENERAL NOTESLAKE GEOMEMBRANE LINER PERGENERAL NOTESCAREFULLY PREPARED LINER SUBGRADEPER GENERAL NOTES - TYPICALTHRU-OUT LIMITS OF LAKEGEOMEMBRANE LINERA"LAID BACK" PLANTERSHORELINE TREATMENT ASSHOWN PER DETAILLK3.2A"LAID BACK" PLANTERSHORELINE TREATMENT ASSHOWN PER DETAILLK3.2PLANTER POCKET(WIDTH VARIES PERSHORE DETAIL)ALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.1SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.com3/16" = 1'-0"SCALE:SCALE:3/16" = 1'-0"La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 519 -9-10-5-8-7-6-3-4+3-2-1+0+1+2+8+7+6+5+4-9-10-5-8-7-6-3-4+3-2-1+0+1+2+8+7+6+5+4-11-9-10-5-8-7-6-3-4+3-2-1+0+1+2+8+7+6+5+4-9-10-5-8-7-6-3-4+3-2-1+0+1+2+8+7+6+5+4-11DEPTH AS SHOWN ON PLAN5'-0"1'-0"OVERLAP6'-0"1PER SECTIONLAKE SYSTEM MEMBRANELINER AS CALLED OUT INGENERAL NOTES - INSTALLPER THE REQUIREMENTS OFTHESE PLANS AND THE LINERMANUFACTURER12" MINIMUM THICK SELECTSOIL COVER OVER THE LAKESYSTEM MEMBRANE LINER -THE SOIL COVER MATERIALSHALL CONFORM TO THEREQUIREMENTS OF THELAKE SYSTEM GENERALNOTES AND THE LINER MFR'SREQMENTS (TYP. THRU-OUT)CAREFULLY PREPARED LINER SUBGRADEPER THE REQUIREMENTS OF THE LAKESYSTEM GENERAL NOTES - TYPICALTHROUGHOUT LAKE BOTTOM & SHORESURFACESLAKESHORELINESHOWN ON PLANLAKE LIMITS SHOWN ON PLANNOTE:REFER TO DETAILS BELOW FOR TYPICALLAKE SHORE ROUGH GRADING, SHORESHAPING AND LAKE EDGE FINISH GRADINGREQUIREMENTS.ALSO... REFER TO LAKE CROSS SECTIONSFOR LAKE BOTTOM SLOPESWATER SURFACE EL. PER PLANLAKEFINISHBOTTOMEL. PERPLANLiner Cover Note:WHERE THE LAKE / POND BOTTOM IS SHOWN SHADED ON THE PLAN VIEW,SUBSTITUTE THE EARTH COVER OVER THE MEMBRANE LINER WITH 3" MIN. THICKCONCRETE VENEER REINFORCED WITH 1" x 1" x 20ga OCTAGONAL WIRE MESH OVERTHE MEMBRANE LINER TO THE LIMITS OF THE SHADED AREA SHOWN ON THE PLANVIEW (TYPICAL). Note: THE LAKE / POND EDGE GRADES SHOWN HERE AREDIAGRAMMATIC - THE FINAL SHAPING TO TIE INTO ADJACENT LANDSCAPE AREAGRADES SHALL BE PREFORMED BY THE LAKE / POND CONTRACTOR IN THE FIELDUNDER THE DIRECTION OF THE OWNER'S REPRESENTATIVEEarth Cover Note:EXCAVATE THE LAKES / PONDS TO THE LINER ELEVATION SHOWN ON THESE PLANS.EARTH COVER MATERIAL SHALL BE GENERATED FROM EXISTING BOTTOM SOILS INSUFFICIENT QUANTITY TO COVER ALL LINER SURFACES SHOWN ON THESE DRAWINGSWHERE CONCRETE VENEER DOES NOT OCCUR. THE MATERIAL SHALL BE SUITABLEFOR LINER COVER AS DESCRIBED IN THE LAKE / POND SYSTEM GENERAL NOTES ANDSHALL BE STOCKPILED ON THE LAKE / POND BOTTOM. THE LAKE / PONDCONTRACTOR SHALL PICKUP AND MOVE THE MATERIAL TO WITHIN THE LAKE / PONDAND SHALL APPLY IT OVER THE LINER AS REQUIRED BY THESE PLANS AND BY THOSEMEANS NECESSARY TO ENSURE THAT THE LINER IS NOT DAMAGED DURING THELINER COVER INSTALLATION PROCESS.IMPORTANT!!PRIOR TO COVER INSTALLATION, THE LAKE / POND CONTRACTOR SHALL DETERMINEIF THE MATERIAL MEETS THE REQUIREMENTS OF THE GENERAL NOTES AND THELINER MANUFACTURER'S RECOMMENDATIONS FOR COVER MATERIAL. IF IT DOES NOTMEET THIS REQUIREMENT, ANOTHER SOURCE OF MATERIAL SHALL BE PROVIDED BYTHE OWNER, AND THE LAKE / POND ENGINEER SHALL BE NOTIFIED IMMEDIATELY.TYPICAL SECTIONthru LAKESCALE: 1/4" = 1'-0""Spoils" Treatment Notes...1. THE "SPOILS" MATERIAL DEPICTED ON THIS DETAIL AND ELSEWHERE IN THESEPLANS, SHALL CONSIST OF APPROXIMATELY 75% FINES TO 1"dia. AND 25% 1"dia.TO 3" dia. COBBLES. THE SPOILS MATERIAL SHALL BE MIXED TOGETHER TOPRODUCE A GRANULAR SOIL AND GRAVEL POND BOTTOM SURFACE TO THELIMITS SHOWN. THE GRAVEL MATERIAL AND SOIL MIXTURE (REFERRED TO AS"SPOILS" ON THESE PLANS) SHALL BE APPROVED FOR COLOR, MIX, ANDAPPEARANCE BY THE LAKE / POND ENGINEER PRIOR TO PLACEMENT IN THESHORE TREATMENT. IF THE MATERIAL WHICH MEETS THESE REQUIREMENTSIS FOUND TO EXIST ON SITE, THE LAKE / POND ENGINEER MAY APPROVE THEIRUSAGE FOR THIS APPLICATION.2. PLACEMENT OF THE "SPOILS" MATERIAL SHALL OCCUR IMMEDIATELY AFTERTHE CONCRETE VENEER IS PLACED AND IS STILL WET. THE VENEER SHALLHAVE A FLOATED SURFACE TEXTURE. IMMEDIATELY AFTER THE CONCRETEVENEER IS PLACED AND BEFORE IT HAS BEGUN TO SETUP, THE CREW SHALLAPPLY THE "SPOILS" MATERIAL BY BROADCASTING BY SHOVEL THE MATERIAL IN ATHIN LAYER (AS NOTED ON THE DETAIL) DIRECTLY ATOP THE CONCRETE SURFACESUCH THAT IT IS COMPLETELY COVERED.ALTERNATE BID ITEM6" THICK (MINIMUM) APPROVED PLATINGMATERIAL BY GRADING CONTRACTOR - SEEGENERAL NOTES FOR ALLOWABLE SOIL TO BEUSED BENEATH GEOMEMBRANE LINERALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.16'-0" APPROXIMATELY5'-0"1'-0"LIMITS OF LAKE EDGE SHOWN ON PLAN6"LAKEWATERSURFACEELEVATIONPER PLANFREEBOARDELEV. PERSHORE DET'L1'-6"1'-0" (MIN)LAKE EDGESHOWN ON PLAN(OVERLAP)LIMITS OF 3" THICK CONCRETE VENEER1'-0"(VARIES)1"SPOILS"THICKNESSVARIES 2"(MIN.) TO 4"1(PER SECTION)COVER WET CONCRETEVENEER WITH "SPOILS" ASCALLED OUT IN "SPOILS" NOTEON THIS SHEETLAKE SYSTEM MEMBRANE LINERTHRU-OUT LIMITS OF LAKE AS CALLEDOUT IN LAKE SYSTEM GENERAL NOTESROCKS AND COBBLES 6"dia. TO 3"dia.LOCATED INTERMITTENTLY ALONGSPOILS TREATMENT IS ALLOWED3" THICK CONCRETEVENEER REINF. WITH 1"x 1" x 20ga. OCTAGONALWIRE MESH THRU-OUT12" THICK SELECTSOIL COVEROVER MEMBRANELINER TO LIMITSSHOWN ON PLANVIEWENLARGED LAKEEDGE DETAILNO SCALEFILL THIS SPACE WITH 3/4" GRAVEL ORCRUSHED ROCK (CONTINUOUS)5'-0"6'-0"1PER SECTION11TO FIT1FITTO6"6"1'-0"5'-0"6'-0"SHOWN ON PLANLAKE LIMITS5'-0"6'-0"5'-0"6'-0"LAKE SHOREPER PLANROUGH GRADE THE LAKEBASINS TO THIS LIMIT +/- 6"WHERE SHOWN ON THE LAKEPLAN VIEW - THE FINISHSURFACE SHALL BE FREE FROMDEBRIS AND ROCKS LARGERTHAN 6"dia. AND SHALL BEGRADED AS SHOWN ON THELAKE PLAN VIEW (UNLESSOTHERWISE NOTED)SLOPE VARIES PERGRADING PLANTHE LAKE CONTRACTOR SHALLINCLUDE AS A PART OF HIS WORK,THE EXCAVATION AND SHORELINESHAPING REQUIRED TO FIT THESHORELINE TREATMENT SHOWN -THE EXCESS SOILS SHALL BESTOCKPILED BY THE LAKECONTRACTOR IMMEDIATELYOUTSIDE THE LAKE SHORELINEFOR FUTURE BACKFILL OVER THECOMPLETED SHORELINE1PER SECTIONTHE LAKE CONTRACTOR SHALLPREPARE THE LINERSUBGRADE, INSTALL WIRE ANDCONCRETE VENEER AND APPLY"SPOILS" TREATMENT OVER THECONCRETE VENEER AS SHOWNON THIS DETAILTHE LAKE CONTRACTOR SHALL COVERTHE LAKE MEMBRANE LINER WITHSELECT SOIL AS CALLED FOR IN THEGENERAL NOTESNote!!FINISH GRADING ANDBACKFILLING BEYOND THATSHOWN HERE SHALL BE BYOTHERS AND NOT A PART OF THELAKE CONSTRUCTION WORKSHOWN ON PLANLAKE LIMITSSHOWN ON PLANLAKE LIMITSSHOWN ON PLANLAKE LIMITSLAKE SHOREPER PLANLAKE SHOREPER PLANLAKE SHOREPER PLANFREEB'DEL. PERSHOREDETAILLAKEWATERSURFACEEL. PERPLANLAKEWATERSURF.EL. PERPLANFREEB'DEL. PERSHOREDETAILLAKEWATERSURFACEEL. PERPLANFREEB'DEL. PERSHOREDETAILLAKEWATERSURFACEEL. PERPLANFREEB'DEL. PERSHOREDETAIL1. Lake Rough GradingSCALE: 1/4" = 1'-0"2. Lake Shore ShapingSCALE: 1/4" = 1'-0"3. Lake Edge TreatmentSCALE: 1/4" = 1'-0"4. Lake Finish GradingSCALE: 1/4" = 1'-0"THE LAKE CONTRACTOR SHALLUSE THE PREVIOUSLY EXCAVATEDAND STOCKPILED SHORELINE SOILMATERIAL TO BACKFILL OVER THELAKE SHORE TREATMENT45INSTALL 12" LONG 2x2WOOD STAKES @ 3'-0"O.C. CONT. - SET TOPOF STAKE AT PONDFREEBOARDELEVATIONLAY A SINGLE #2 BARCONTINUOUS AT TOP OFSTAKE AND CONNECTWITH "U" NAILS (1 ea.PER STAKE)STAKES AND #2 BARARE TO BE LEFT INPLACE AFTERBACKFILLAS SHOWNSCALE:SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 520 1'-6"6"4'-0"PLANTER AREA VARIES 8'-0" - 12'-0" (SEE PLAN)3'-6"1'-0"3'-0" MAX.1'-0"6"6"6"LAKE WATERSURFACE EL.PER PLANFREEBOARDELEVATIONPER PLAN1'-0"1'-0"1'-0"6"LAKE SHORELINESHOWNONPLANCURBSHOWN ONPLANPER SHORE DETAIL112LAKE WIDTH VARIES PER PLAN3" THICK CONCRETE VENEER OVERMEMBRANE LINER REINFORCED WITH 1" x1" x 20ga. OCT. WIRE MESH THROUGHOUTCAREFULLY PREPARED NATIVE SOIL SUBGRADE AS DESCRIBED IN THE LAKESYSTEM GENERAL NOTES THROUGHOUT THE LIMITS OF THE LAKE MEMBRANELINER SYSTEMLAKE SYSTEM MEMBRANE LINER AS CALLED OUT IN LAKE SYSTEM GENERALNOTES - INSTALL LINER PER THE REQUIREMENTS OF THESE PLANS AND THE LINERMANUFACTURERCOVER WET CONCRETE VENEER WITH"SPOILS" TREATMENT WHICH VARIESIN THICKNESS FROM 2" THICK(MINIMUM) TO 4" THICK (MAXIMUM) TOCOMPLETELY COVER THE VENEERBELOW. - SEE "SPOILS" TREATMENTNOTES ON EDGE DETAIL FOR MOREINFORMATIONUSE 6 X 8 X 16 CMU BLOCK AS FILLERCOVERED WITH ONE LAYER OF 1" X 1"X 20ga OCT. WIRE MESH CONTINUOUSSPECIAL SOIL MIX FORWATER PLANTS ASSPECIFIED BY THEPROJECT LANDSCAPEARCHITECT (IF REQUIRED)- VERIFY MIX WITHLANDSCAPE ARCH IN THEFIELDNote:AQUATIC PLANT DESIGN AND INSTALLATION BY OTHERS - VARIOUS WATERPLANTS AS SPECIFIED BY THE LANDSCAPE DESIGNER - NOT A PART OFWATER FEATURE CONSTRUCTIONCONCRETE KEY CONTINUOUSTO SIZE SHOWN (TYPICAL)FORM CURB TO SEPARATE SITE SOILSFROM PLANTER SOIL AS SHOWNCONTINUOUS - COVER WITH SPOILSBACKFILL THIS AREA TO LEVELSHOWN WITH 3/4" GRAVEL ORCRUSHED ROCK CONTINUOUSSamplePhoto"Spoils" Note:FOR MATERIALS ANDINSTALLATION OFDECORATIVE SPOILSSEE LAKE SHORELINETREATMENT DETAILS(TYPICAL)ALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.1FREEBOARDELEV. PERSHORELINEDETAILPONDWATERSURFACEEL. PERPLAN6"1'-6"LIMIT OF 4" THICK CONCRETE VENEERREINFORCED WITH (2) LAYERS OF1' x 1" x20ga. OCTAGONAL WIRE MESH2'-0"VARIES WITH ROCK SIZEPOND SYSTEM MEMBRANE LINERPER GENERAL NOTESTHROUGHOUT LIMITS OF PONDTO FREEBOARD ELEVATIONPOND BOTTOMSURFACE ANDSHORELINE FINISHSURFACE TREATMENTSHALL BE AS CALLEDOUT ON SHORELINEDETAIL (TYP.)1PER SHOREDETAILFILL ALL VOIDS SOLIDWITH CONCRETESIZE POCKET TO RECEIVESELECTED BOULDERS (6 FOOTBOULDER DIAMETER MAXIMUM)21SamplePhotoBid Note:THE LAKE CONTRACTOR SHALL PROVIDE AUNIT PRICE (PER LINEAL FOOT) AS A PART OFHIS BID FOR THIS SHORE TREATMENT. THELANDSCAPE ARCHITECT SHALL DETERMINETHE LOCATIONS AND EXTENTS OF THISTREATMENT IN THE FIELDALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.1SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:1" = 1'-0"SCALE:1" = 1'-0"La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 521 Liner PanelInstallationLiner PanelField SeamingPipe BootInstallationSubgradePreparationSUBGRADE SHALL BEABSOLUTELY SMOOTH - USEROLLER - COMPACTOR PER"VOLVO model SD70 vibratoryroller" OR LARGER AS REQUIREDAND HAND RAKING TO ACHIEVETHIS LEVEL OF SMOOTHNESSAND UNIFORMITY4" (MIN.) to 6" (MAX.)2" BONDWIDTH MINIMUMPIPEBOOTPIPETAC-TAPESTAINLESSSTEEL CLAMPPIPE BOOT SKIRTWELD ALL 4 SIDESPREPAREDSUBGRADEPIPE BOOTPROVIDE SLACKAT BENDEDEDGEFIELD SEAM (4)SIDESGEOMEMBRANELINERPIPE BOOT1/4" X 2" FLAT STAINLESSSTEEL , ALUMINUM ORPOLYPROPYLENE BARBUTYL TAC TAPE3/8" x 3" LG S.S. ANCHORBOLT, NUT AND WASHER12" O.C. (ABOVE WATERLEVEL) 6" O.C. (BELOWWATER LEVEL)GEOMEMBRANE LINERCONCRETE STRUCTURE1/4" X 2" FLAT STAINLESSSTEEL , ALUMINUM ORPOLYPROPYLENE BARBUTYL TAC TAPE3/8" x 3" LG S.S. ANCHORBOLT, NUT AND WASHER12" O.C. (ABOVE WATERLEVEL) 6" O.C. (BELOWWATER LEVEL)GEOMEMBRANE LINERCONCRETE STRUCTUREPREPAREDSUBGRADESEAM TO BE MADE USING HOT AIR / HOTWEDGE WELDING TECHNIQUESLOOSE EDGE MAY OCCUR ON THERMALSEAMSGEOMEMBRANELINER PERGENERALNOTESVertical Surface Horizontal SurfaceField Seal to Concrete StructureField Seam / Splice DetailFactory Fabricated Pipe Boot(on slope) ALL PIPE SIZESThe LAKE System Geomembrane Liner Shall be:30 mil LLDPE-R(Scrim Reinforced LLDPE)as manufactured by . . .1.0 GENERAL1.1 SCOPE OF WORK RELATED TO POND (RESERVOIR) LINER WORK.THE LINER MANUFACTURER PRODUCES REINFORCED LINEAR LOW DENSITYPOLYETHYLENE (LLDPE) GEOMEMBRANE FABRICS IN 30 AND 45 MILTHICKNESSES. THE FOLLOWING INSTALLATION INSTRUCTIONS ARE MEANTAS A MINIMUM SET OF STANDARDS THAT ARE TO BE FOLLOWED. ALL WORKSHALL BE DONE IN STRICT ACCORDANCE WITH THE POND ENGINEER'SDRAWINGS AND SPECIFICATIONS AND THE FABRICATOR'S APPROVED SHOPDRAWINGS.1.2 DESCRIPTION OF THE PRODUCTSLLDPE GEOMEMBRANE FABRICS ARE PRODUCED IN THE FABRICATOR'SFACILITY. THE GEOMEMBRANE IS REINFORCED WITH A 9 X 9, 1000 DENIERWEFT INSERTED WARP KNIT POLYESTER SCRIM. THE SCRIM HAS BEENDESIGNED FOR HIGH TENSILE AND TEAR STRENGTH. IN THE PRODUCTIONPROCESS, THE LONGITUDINAL EDGES OF THE SCRIM ARE ENCAPSULATED BYTHE COATING LAYERS.THE 30 AND 45 MIL LLDPE GEOMEMBRANE FABRICS HAVE BEEN EXTRUSIONCOATED WITH A HIGH FLEXIBILITY MATERIAL. THE COATING ALSO CONTAINSPIGMENTS AND ULTRAVIOLET (UV) INHIBITORS. THE FINISHED MEMBRANESHALL MEET OR EXCEED THE PHYSICAL PROPERTY VALUES SHOWN ON THEDATA SHEET BELOW:2.0 PRODUCTION AND HANDLING OF PANELS2.1 FACTORY FABRICATION OF PANELSGEOMEMBRANE FABRICS ARE FLEXIBLE ENOUGH TO ALLOW FOR FACTORYWELDING AND FOLDING OF PANELS FOR DELIVERY TO THE INSTALLATIONSITE. WHENEVER POSSIBLE THE USE OF FACTORY SEAMS AND LARGEPANELS SHALL BE MAXIMIZED. THE FABRICATOR SHALL PRODUCE THEPANELS WITH WELDS N THE PATTERN AND DIRECTIONS AS SHOWN ON THEPLANS AND / OR THE FABRICATOR'S APPROVED SHOP DRAWINGS.ALL FACTORY WELDS SHALL BE PRODUCED USING A THERMAL WELDINGSYSTEM SUCH AS A HOT WEDGE OR HOT AIR WELDER. THE FABRICATORSHALL HAVE EXPERIENCE IN WELDING A MINIMUM OF 2,000,000 SQUARE FEETOF GEOMEMBRANE FABRIC USING A THERMAL WELDING SYSTEM. THEMINIMUM WIDTH OF FACTORY SEAMS SHALL BE 2". ALL SEAMS SHALL BEINSPECTED TO ENSURE THE QUALITY AND UNIFORMITY OF THE WELDS. ANYPORTION OF THE WELD AREA THAT DOES NOT PASS VISUAL INSPECTION FORREASONS SUCH AS AN UNWELDED EDGES, EXPOSURE OF THE SCRIM, ETC,MUST BE REPAIRED BY THERMAL WELDING OR THE USE OF A PROPERWELDING ROD MATERIAL PRIOR TO THE PANEL BEING SHIPPED.IN ADDITION TO VISUAL INSPECTION, A 48" SAMPLE SHALL BE TAKEN FROMEACH FACTORY SEAM WELDING UNIT USED IN THIS WORK AT THE BEGINNINGOF EVERY WORK SHIFT AND EVERY FOUR HOURS OF PRODUCTIONTHEREAFTER. SAMPLES SHALL BE NON-DESTRUCTIVE AND SHALL NOTREQUIRE PATCHING OF FABRICATED PANELS. TEST SPECIMENS SHALL BECUT AT QUARTER POINTS FROM EACH 48" SEAM SAMPLE (A TOTAL OF 3PLACES) AND TESTED FOR FACTORY SEAM STRENGTH AND PEEL ADHESION.THE SHEAR SEAM STRENGTH SHALL BE TESTED IN ACCORDANCE WITH ASTMD75 1 AS MODIFIED IN ANNEX A OF 54. A LOG SHALL BE MAINTAINED SHOWINGTHE DATE, TIME, PANEL NUMBER AND TEST RESULTS. FAILURE OF THEMATERIAL SEAMS TO MEET ALL OF THE REQUIREMENTS OF THESESPECIFICATIONS SHALL BE CAUSE FOR REJECTION OF THE MATERIAL SEAMS.THE FABRICATOR SHALL PROVIDE THE TEST RESULTS TO THE PONDENGINEER AND / OR OWNER UPON REQUEST.2.2 FABRICATED PANEL PACKAGING AND STORAGEEACH FACTORY FABRICATED PANEL SHALL BE ROLLED ORACCORDION-FOLDED AND PLACED ONTO A STURDY WOODEN PALLETDESIGNED TO BE MOVED BY A FORKLIFT OR SIMILAR EQUIPMENT. EACHPANEL SHALL BE GIVEN PROMINENT AND UNIQUE IDENTIFYING MARKINGSINDICATING THE PROPER DIRECTION OF UNROLLING AND / OR UNFOLDING TOFACILITATE LAYOUT AND POSITIONING IN THE FIELD. THE PANELS SHALL BEPACKAGED AND FULLY ENCLOSED ON A WOODEN PALLET WITH PLASTICCOVER AND SHRINKWRAP AND PROTECTED TO PREVENT DAMAGE DURINGSHIPMENT AND EACH CRATE IS TO BE PROMINENTLY MARKED IN THE SAMEFASHION AS THE PANELS WITHIN. UNTIL NEEDED, PACKAGED FACTORYFABRICATED PANELS SHALL BE STORED IN THEIR ORIGINAL UNOPENEDCRATES IN A DRY AREA, AND PROTECTED FROM THE DIRECT HEAT OF THESUN. DO NOT STACK PALLETS.3.0 INSTALLATION AND FIELD SEAMING3.1 SUBGRADE PREPARATIONTHE SURFACES ON WHICH THE LINING IS TO BE PLACED SHALL BEMAINTAINED IN A FIRM, CLEAN, DRY AND SMOOTH CONDITION DURING THELINING INSTALLATION. ALL EARTHEN SURFACES TO RECEIVE THE LININGSHALL BE COMPACTED AND SMOOTH GRADED WITH FREEBOARDANCHORAGES AS SHOWN ON THE POND SYSTEM DETAILS. ALL SURFACES TORECEIVE THE LINING SHALL BE FREE OF ROCKS, ROOTS, GRAVEL, GRADESTAKES OR DEBRIS THAT MAY PUNCTURE THE GEOMEMBRANE. THESUBGRADE SURFACE TO RECEIVE THE LINING SHALL BE COMPACTED INACCORDANCE WITH THE PROJECT GRADING PLANS. ALL VEGETATION, IFPRESENT, SHALL BE REMOVED. IF GROUNDWATER IS PRESENT WITHIN 12"BELOW THE SURFACE TO BE LINED, THE AREA SHALL BE DEWATERED PRIORTO, AND DURING THE INSTALLATION OF THE LINER. THE LINER SHALL BEINSTALLED AT A HEIGHT ABOVE THE MAXIMUM ANTICIPATED HEIGHT OF THEGROUNDWATER TABLE IF GROUNDWATER IS PRESENT ON THIS SITE.THE LOCATION OF BOTH THE TOP AND BOTTOM OF ALL SLOPES SHALL BECOMPLETED WITHIN PLUS OR MINUS 1 FOOT OF THE PLANED LOCATION. THECOMPLETED FINISH GRADES SHALL BE WITHIN PLUS OR MINUS 0.1 FOOT OFTHE SPECIFIED ELEVATION, UNLESS OTHERWISE NOTED ON THESE PLANS.IMMEDIATELY PRIOR TO THE INSTALLATION OF THE GEOMEMBRANE, ACOMPLETE AND DETAILED INSPECTION OF THE EMBANKMENTS SHALL BEPERFORMED BY THE FIELD ENGINEER, EARTHWORK CONTRACTOR ANDGEOMEMBRANE INSTALLER TO DETERMINE ACCEPTANCE OF THE FINISHEDSUBGRADE AND ELEVATIONS. ANY EROSION OR OTHER DAMAGE TO THEBASE MATERIAL WHICH HAS OCCURRED SINCE PLACEMENT SHALL BECORRECTED BY THE GRADING CONTRACTOR.3.2 GEOMEMBRANE INSTALLATIONTHE GEOMEMBRANE SHALL BE PLACED OVER THE PREPARED SURFACES INSUCH A MANNER AS TO INSURE MINIMUM HANDLING AND IN ACCORDANCEWITH THE APPROVED SHOP DRAWINGS AND THE POND PLANS. THE LININGSSHALL BE SEALED TO ALL CONCRETE STRUCTURES AND OTHER OPENINGS INACCORDANCE WITH DETAILS SHOWN HERE AND IN THE APPROVEDFABRICATOR'S SHOP DRAWINGS. THE GEOMEMBRANE LINING SHALL BECLOSELY FITTED AND SEALED AROUND ALL INLETS, OUTLETS AND OTHERPROJECTIONS THROUGH THE LINING USING PREFABRICATED FITTINGS (PIPEBOOTS) AS SHOWN ON THESE PLANS. LINER SHEETS DAMAGED FROM ANYCAUSE SHALL BE REMOVED, REPAIRED, OR COVERED WITH ADDITIONALSHEETING.ONLY THOSE SHEETS OF LINING MATERIAL WHICH CAN BE ANCHORED ANDSEAMED TOGETHER THE SAME DAY SHALL BE UNPACKED AND PLACED INTOPOSITION. IN AREAS WHERE HIGH WIND IS PREVALENT, THE LININGINSTALLATION SHALL BEGIN ON THE UPWIND SIDE OF THE PROJECT ANDPROCEED DOWNWIND. THE LEADING EDGE OF THE LINER SHALL BESECURED AT ALL TIMES WITH SANDBAGS SUFFICIENT TO HOLD IT DOWNDURING HIGH WINDS. THE LEADING EDGES OF THE LINER MATERIAL LEFTEXPOSED AFTER THE DAY'S WORK SHALL BE ANCHORED TO PREVENTDAMAGE OR DISPLACEMENT DUE TO WIND.MATERIALS, EQUIPMENT OR OTHER ITEMS SHALL NOT BE DRAGGED ACROSSTHE SURFACE OF THE LINER OR BE ALLOWED TO SLIDE DOWN SLOPES ONTHE LINING. ALL PARTIES WALKING OR WORKING ON THE LINING MATERIALSSHALL WEAR SOFT SOLED SHOES.3.3 FIELD SEAMSLAP JOINTS SHALL BE USED TO SEAL FACTORY FABRICATED SHEETSTOGETHER IN THE FIELD. THE LAP JOINT SHALL BE FORMED BY LAPPING THEEDGES OF THE SHEETS FOUR (4) TO SIX (6) INCHES. THE CONTACTSURFACES OF THE SHEETS SHALL BE WIPED CLEAN OF ALL DIRT, DUST,MOISTURE AND OTHER FOREIGN MATTER. A MINIMUM 2" BOND SHALL APPLYTO ALL FIELD SEAMS. EXTREME CARE SHALL BE TAKEN THROUGHOUT THEWORK TO AVOID FISHMOUTHS, WRINKLES, FOLDS OR PLEATS IN THE SEAMAREA. IF FISHMOUTHS DO OCCUR, THEY SHALL BE SLIT OUT FAR ENOUGHFROM THE SEAM TO DISSIPATE THEM, LAPPED, SEAMED TOGETHER IN THELAPPED AREA AND PATCHED. ANY NECESSARY REPAIRS TO THEGEOMEMBRANE SHALL BE DONE USING AN ADDITIONAL PIECE OF THESPECIFIED SHEETING APPLIED AS STATED IN SECTION 4 OF THISSPECIFICATION. CLEANUP WITHIN THE LINING COMPOUND SHALL BE ANONGOING RESPONSIBILITY OF THE LINING INSTALLER. PARTICULAR CARESHALL BE TAKEN TO ENSURE THAT NO STONES, SCRAP MATERIAL, TRASH,TOOLS OR OTHER UNWANTED ITEMS ARE TRAPPED BENEATH THE LINER.ALL FIELD SEAMS SHALL BE MADE UTILIZING THE HOT AIR OR HOT WEDGEWELDING TECHNIQUES AS OUTLINED IN APPROPRIATE SECTIONS OF THE EPATECHNICAL GUIDANCE DOCUMENT "INSPECTION TECHNIQUES FOR THEFABRICATION OF GEOMEMBRANE FIELD SEAMS".4.0 INSPECTION AND TESTING OF SEAMS4.1 INSPECTIONUPON COMPLETION OF THE LINER INSTALLATION, ALL SEAMS SHALL BEVISUALLY INSPECTED FOR COMPLIANCE WITH THESE SPECIFICATIONS ANDTHE POND PLANS. IN ADDITION TO VISUAL INSPECTION, ALL FIELD SEAMSSHALL BE CHECKED USING AN AIR LANCE NOZZLE DIRECTED ON THE UPPEREDGE AND SURFACE TO DETECT ANY LOOSE EDGES OR RIFFLES INDICATINGUNBONDED AREAS WITHIN THE SEAM (PER ASTM D4437). ANY DEFECTS INTHE WELD SHALL BE REPAIRED BY THERMAL WELDING.ALL FIELD SEAMS, ON COMPLETION, SHALL BE TIGHTLY BONDED. ANYGEOMEMBRANE SURFACE SHOWING INJURY DUE TO SCUFFING,PENETRATION BY FOREIGN OBJECTS, OR DISTRESS FROM OTHER CAUSESSHALL BE REPLACED OR REPAIRED. ALL EXPOSED SCRIM EDGES SHALL BESEALED WITH AN APPROVED EXTRUSION WELDING BEAD OR CAP STRIPPED.4.3 TESTING OF FIELD SEAMSTEST SEAMS ARE TO BE MADE BY EACH SEAMING CREW AT THE BEGINNINGOF THE SEAMING PROCESS, AND EVERY FOUR (4) HOURS THEREAFTER, OREVERY TIME THE WELDING EQUIPMENT IS CHANGED. EACH SEAMING CREWAND THE MATERIALS THEY ARE USING SHALL BE TRACEABLE ANDIDENTIFIABLE TO THEIR TEST SEAMS. THE SAMPLES SHALL BE NUMBERED,DATED, IDENTIFIED AS TO THE PERSONNEL MAKING THE SEAM, ANDLOCATION MADE, BY APPROPRIATE NOTES ON A PRINT OF THE PANELLAYOUT FOR THE PROJECT. THE COMPLETED FIELD SEAM SAMPLE SHALLMEASURE NOT LESS THAN 14" IN WIDTH AND 24" IN LENGTH.THE FIELD TEST SEAMS ARE TO BE TESTED FOR ADHESION BY USE OF AN AIRLANCE TESTING MACHINE. IF A TEST SEAM FAILS TO MEET THE FIELD SEAMDESIGN SPECIFICATION, THEN ADDITIONAL TEST SEAM SAMPLES WILL HAVETO BE MADE BY THE SEAMING CREW, USING THE SAME TOOLS, EQUIPMENTAND SEAMING MATERIALS, AND RETESTED.5.0 WARRANTYTHE LINING MANUFACTURER SHALL PROVIDE A PRO-RATA WEATHERINGWARRANTY FOR THE GEOMEMBRANE LINER PRODUCT THAT IT IS FREE FROMMANUFACTURING DEFECTS AT THE TIME OF SALE AND AGAINSTDETERIORATION DUE TO THE EFFECTS OF ULTRAVIOLET LIGHT FOR A PERIODOF UP TO 20 YEARS FROM THE DATE OF THE COMPLETED INSTALLATION. THEWARRANTY WILL BE IN FORCE ONLY AFTER THE OWNER OR LEGALREPRESENTATIVE OF THE ENTITY OWNING THE INSTALLED LINER HAS SIGNEDTHE WARRANTY.PIPETAC-TAPESTAINLESSSTEEL CLAMPPIPE BOOTSKIRT WELDALL 4 SIDESPREPAREDSUBGRADEPIPE BOOTPROVIDE SLACKAT BENDED EDGEFIELD SEAM (4)SIDESGEOMEMBRANELINERPIPEBOOTFactory Fabricated Pipe Boot(vertical) ALL PIPE SIZESGeomembrane LinerSpecifications:Contact:TITAN ENVIRONMENTAL, USA950 Beaumont Ave, #830,Beaumont, CA, 92223Mr. Daniel Watson ph: 951-630-0401,daniel.watson@titanenviro.comwww.titanenviro.comSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comNONESCALE:03-28-202503-28-2025La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 522 3'-0"6"6"EQ.EQ.1'-6" CURB1'-0"3"6'-0" (MINIMUM)RETURN3'-0"RETURN6'-0"TROUGH WIDTHCTROUGHWHERE SHOWNON PLANTOE OF SLOPESECSECSECSECSHORELINETREATMENT ASCALLED OUT ON LAKEPLAN VIEWEARTH COVEROVER MEMBRANELINERSELECTSOILCOVERFORM TROUGH WALLSWITH HAND FORMEDCONCRETEREINFORCED WITHHAND BENT WIREREINF. AS SHOWN3" THICKCONCRETEVENEER REINF. w/1"x1"x20ga.OCTAGONAL WIREMESH OVERMEMBRANE LINERTROUGHPLAN VIEWSECTIONSCALE: 1-1/2" = 1'-0"SCALE: 1/2" = 1'-0"6"6"EQ.EQ.1'-6" CURB1'-0"3"SELECTSOILCOVERFORM TROUGH WALLSWITH HAND FORMEDCONCRETEREINFORCED WITHHAND BENT WIREREINF. AS SHOWNSECTIONSCALE: 1-1/2" = 1'-0"LAKE LIMITS AS SHOWN ON PLANDEPTHPER PLANVARIES 4'-0" MIN.TO 6'-0" MAX.3"MIN.WATERSURFACEELEVATIONPERPLANLAKEEDGESHOWN ONPLAN3'-6" MINIMUMDISCHARGEPIPE (LINESIZEPER PLAN)SEAL DISCHARGEPIPE TO LINER ASSHOWN PERDETAIL.ALK3.3CONCEAL FILLPIPE WITHPLANTING ANDROCKS - SEEPLAN VIEWPAINT ALLEXPOSEDPIPELINESBLACK INCOLOR TOCONCEALUSE GROUTED ROCKTO PREVENT EROSIONWHEN FILLINGSHORELINE ASSHOWN PERDETAIL.ALK3.1Note:FOR ALTERNATE LINER SUBGRADETREATMENTS (NOT SHOWN HERE)SEE DETAILALK2.11'-3"6"MIN.PER DETAIL112LAKE EDGEPER PLANVARIES WITH ROCKFILL PIPEPER PLAN1'-0"MIN.PAINT ALLEXPOSEDPIPELINE BLACKIN COLOR TOCONCEALALK3.1SPANBOULDERSOVER FILL PIPETO FURTHERCONCEALWATERSURFACEELEVATIONPERPLAN6"MIN.SHORELINEBEYONDPERCONSTRUCTROCK POCKET ASSHOWN TORECEIVE ROCKS -GROUT ROCKSSOLID IN PLACEWITH CONCRETELAKE LIMITS AS SHOWN ON PLANNote:FOR ALTERNATE LINER SUBGRADETREATMENTS (NOT SHOWN HERE) SEE DETAILALK2.1LAKE WATERSURFACE EL.PER PLAN3'-0"FREEBOARDELEVATIONPER PLAN3"6"8"6'-0" (APPROXIMATELY)LAKESHORETREATMENTPERLAKESHORELINESHOWN ONPLANSTORMFLOW#3 BARS @24" O.C.CONTINUOUS(4) #3 BARSHORIZONTALCONTINUOUSPOURED INPLACECONCRETECUT-OFF WALLCONTINUOUSTERMINATE LINER HEREALK3.1COVER CONCRETE VENEERWITH "SPOILS" TREATMENT TOTHE DEPTH SHOWN ON THECROSS SECTION - COLOR OF"SPOILS" TREATMENT TOMATCH COLOR OF ROCK ANDCOBBLE (TYPICAL)3" MIN. THICK CONCRETEVENEER REINFORCEDWITH 1" x 1" x 20ga.OCTAGONAL WIRE MESHOVER LINER TO LIMITSSHOWN ON PLAN VIEWCAREFULLY PREPARED LINER SUBGRADE PER THEREQUIREMENTS OF THE LAKE SYSTEM GENERAL NOTES -TYPICAL THROUGHOUT LAKE BOTTOM & SHORE SURFACESLAKE SYSTEM MEMBRANE LINER AS CALLED OUT INGENERAL NOTES - INSTALL PER THE REQUIREMENTSOF THESE PLANS AND THE LINER MANUFACTURER"Spoils" Note:FOR MATERIALS ANDINSTALLATION OFDECORATIVE SPOILSSEE LAKE SHORELINETREATMENT DETAILS(TYPICAL)Note:FOR ALTERNATE LINERSUBGRADETREATMENTS (NOTSHOWN HERE) PERALK2.1SHOWN ON PLAN - CONCEALWEIR W/ COBBLE AS SHOWNCOBBLE BOTTOM WHEREVENEER REINFORCED W/WIRE MESH OVER MEMBRANELINER PER GENERAL NOTES1" X 1" X 20 GA. OCT.POND BOTTOMPER PLAN3" THICK CONCRETEEQUAL6"EQUAL11LIMITS OF POND PER PLANLINER FLAP CONT. AS SHOWN- ADHERE TO MEMBRANE LINERW/ LINER-TO-LINER ADHESIVETOP OF WEIRELEV. PER PLANPOND WATERSURFACE ELEV.PER PLANC WEIR1-1/2"1-1/2"1/2" 1/2"PER LINER MFR.10"TYPICALFOR MORE INFO.PER PLAN - SEE DETAILLK3.5ALK3.6ASTRM WFALLSTREAM / WATERFALLSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:SCALE:1" = 1'-0"SCALE:3/4" = 1'-0"3/4" = 1'-0"SCALE:AS SHOWNSCALE:SCALE:1-1/2" = 1'-0"1" = 1'-0"SCALE:AS SHOWNSCALE:AS SHOWN03-28-202503-28-2025La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 523 TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"3'-8"TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"3'-8"TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"3'-8"BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)FILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)SELECT 3'-0" HIGHBOULDER - SLOPEBACKFILL TO TERMINATEAT BACK OF BOULDEREXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATION1'-6"APPROX.DRAWDOWNPER GCSUPER.11 (MAXIMUM)13 (VFY)DETAIL "1"DETAIL "2"DETAIL "3"1'-6"APPROX.DRAWDOWNPER GCSUPER.1'-6"APPROX.DRAWDOWNPER GCSUPER.BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYFILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)SELECT ROCKS AGAINSTEXISTING VERTICAL WALL -SLOPE BACKFILL TOTERMINATE AT BACK OFBOULDEREXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATION11 (MAX.)13 (VFY)BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH #3BARS @ 16" O.C. 4" MIN.EMBEDMENT HILTI HY 200V3 EPOXY (ESR 4868)STACKED 12" CONCRETECMU BLOCKS - SECURE INPLACE WITH NON-SHRINKGROUT (TYP.)RUN SPOILS TREATMENTOVER CMU BLOCKS ANDGROUT AS SHOWN TOCONCEAL - MEET GRASSAT LAKE WATER LEVELEXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATION11 (MAXIMUM)13 (VFY)EXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)EXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"4'-4"DETAIL "1"DETAIL "2"1'-6"APPROX.DRAWDOWNPER GCSUPER.1'-6"APPROX.DRAWDOWNPER GCSUPER.BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)SELECT ROCKS AGAINSTEXISTING VERTICAL WALL -SLOPE BACKFILL TOTERMINATE AT BACK OFBOULDEREXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATIONEXTEND 4" THICK CONCRETEVENEER (f'C = 2500psi MIN.)OVER EXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)STACKED 12" CONCRETECMU BLOCKS - SECURE INPLACE WITH NON-SHRINKGROUT (TYP.)RUN SPOILS TREATMENT OVER CMU BLOCKSAND GROUT AS SHOWN TO CONCEAL - MEETGRASS AT LAKE WATER LEVEL11 (MAXIMUM)13 (VFY)3"6"3"FILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)SPECIAL SOIL MIX FORWATER PLANTS ASSPECIFIED BY THE PROJECTLANDSCAPE ARCHITECT (IFREQUIRED) - VERIFY MIXWITH LANDSCAPE ARCH INTHE FIELDNote:AQUATIC PLANT DESIGN AND INSTALLATION BY OTHERS - VARIOUSWATER PLANTS AS SPECIFIED BY THE LANDSCAPE DESIGNER - NOT APART OF WATER FEATURE CONSTRUCTION11 (MAX.)BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACEFILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)Note:AQUATIC PLANT DESIGN AND INSTALLATION BY OTHERS - VARIOUSWATER PLANTS AS SPECIFIED BY THE LANDSCAPE DESIGNER - NOT APART OF WATER FEATURE CONSTRUCTION3"6"3"COVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATIONSPECIAL SOIL MIX FORWATER PLANTS ASSPECIFIED BY THE PROJECTLANDSCAPE ARCHITECT (IFREQUIRED) - VERIFY MIXWITH LANDSCAPE ARCH INTHE FIELD2'-0"1'-0"13 (VFY)1'-0"2'-0"4'-4"SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:3/4" = 1'-0"SCALE:3/4" = 1'-0"03-28-202503-28-2025La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 524 LOCATION OFEXISTING LAKESHORELINE EDGE -EXISTING EDGECONSISTS OFSLOUGHED OFF SOILAND SOD IN ANIRREGULAR SHAPEAND POSITIONOVERFILL THIS AREA ASSHOWN TO ALLOW FORCUTTING OF THE LAKESHORELINE CONTINUOUSTHE LAKE EDGE SHALL BE FILLED WHERE SHOWN ON THE PLAN VIEWIN COMPACTED LIFTS PER THE REQUIREMENTS OF THE LAKEGRADING AS CALLED OUT IN THE "LAKE EDGE GRADING NOTES"SHOWN THIS DETAILLake Edge Over excavation and Compacted Fillonly occurs in lake edge "fill" areas shown on the lake plan viewWATERSURF. ELEXISTING2'-0"(MIN.)4'-0"(MINIMUM)SEE PLAN VIEW FOREXISTING LAKE LIMITSSEE PLAN VIEW FORNEW LAKE LIMITS5'-0" (MIN.)EXISTING LAKEEDGE PER PLANOVER EXCAVATE ANDFILL PER NOTESLK3.1ANEW LAKE SHORELINE TREATMENTWHERE SHOWN ON THE LAKE PLAN VIEWAND TO BE CONSTRUCTED PER DETAILNEWLAKEEDGEPERPLANVIEWFILL AREA TO LIMITS SHOWN ON PLANVIEW WHERE SHOWN ON PLANLake Edge Grading Notes(does not apply to project mass grading)1. ALL WORK SHALL CONFORM TO THE LATEST ADOPTED EDITION OF THE BUILDING CODE AND ALL LOCAL CODES AND ORDINANCES. AN EFFORT HAS BEEN MADE TO DEFINE THE LOCATION OF UNDERGROUNDFACILITIES WITHIN THE WORK AREA. HOWEVER, ALL EXISTING UTILITY AND OTHER UNDERGROUND STRUCTURES MAY NOT BE SHOWN ON THIS PLAN AND THEIR LOCATION WHERE SHOWN SHALL BE DEEMED TOBE APPROXIMATE. THE OWNER SHALL BE RESPONSIBLE FOR LOCATING, MARKING AND IF NECESSARY, SHUTTING DOWN AND/OR RELOCATING ALL UNDERGROUND UTILITIES AND RELATED FACILITIES ORIRRIGATION LINES AND FOR PROTECTING SAME DURING THE COURSE OF CONSTRUCTION. THE OWNER SHALL CONTACT UNDERGROUND SERVICE ALERT (U.S.A.) AT 1-800-542-2444 2 WORKING DAYS PRIOR TO THESTART OF CONSTRUCTION FOR ASSISTANCE FROM THE RESPECTIVE UTILITIES. ALL UTILITIES NOT A MEMBER OF U.S.A. SHALL ALSO BE NOTIFIED.2. ALL AREAS TO RECEIVE FILL SHALL BE CLEARED OF ALL BRUSH AND OTHER OBJECTIONABLE DEBRIS, INCLUDING EXISTING SOD AND OTHER ORGANIC MATERIALS, SCARIFIED TO A DEPTH OF 1 FOOT ANDWATERED AND COMPACTED TO 90% RELATIVE DENSITY IN LAKE AREAS PER THE REQUIREMENTS OF A.S.T.M. DESIGNATION D-1557-65T, OR AS APPROVED BY THE LAKE ENGINEER. THE FILL MATERIAL SHALL BEPLACED IN COMPACTED LAYERS AS SHOWN ON THE LAKE EDGE CONSTRUCTION DETAILS AND FILLED AND COMPACTED AT OPTIMUM MOISTURE CONTENT BY AN APPROVED METHOD. THIS PROCEDURE SHALLAPPLY ONLY TO THE LAKE SHORELINE FILLS ON THIS PROJECT AND IS NOT INTENDED TO BE USED FOR BUILDINGS OR OTHER STRUCTURES.3. ALL EXISTING LAKE BOTTOM SOIL SHALL BE REUSED IN THE LAKE AREA, WITH REMOVED ORGANICS, BUSHES, TREES, ETC. TO BE STOCKPILED ADJACENT TO THE LAKE FOR REMOVAL / DISPOSAL BY THEOWNER.4. THE CONTRACTOR SHALL EMPLOY ALL LABOR, EQUIPMENT AND METHODS REQUIRED TO PREVENT HIS OPERATIONS FROM PRODUCING DUST IN AMOUNTS DAMAGING TO PROPERTY, CULTIVATEDVEGETATION AND DOMESTIC ANIMALS, OR CAUSING A NUISANCE TO PERSONS OCCUPYING BUILDINGS IN THE VICINITY OF THE JOB SITE. THE OWNER SHALL PROVIDE A SUFFICIENT WATER SOURCE FORCONSTRUCTION WATER AND SHALL BE RESPONSIBLE FOR ALL WATER COSTS THROUGHOUT THE COMPLETION OF THE LAKE CONTRACTOR'S WORK.5. THE OWNER SHALL DESIGNATE WORK EQUIPMENT TRAVEL PATHS THRU THE PROJECT WHICH ALLOWS THE CONTRACTOR TO ACCESS THE WORK AREA WITH EQUIPMENT AND SHALL ALTER GOLF PLAY ASREQUIRED TO PROTECT THE SAFETY OF THE CONTRACTORS WORKMEN DURING THE COURSE OF THE WORK. THE CONTRACTOR SHALL MAKE A REASONABLE EFFORT TO PROTECT EXISTING IRRIGATIONCOMPONENTS ETC. DURING THE COURSE OF THE WORK HOWEVER THE OWNER SHALL BEAR THE COSTS OF REPAIRING OR REPLACING ANY AND ALL COMPONENTS AND / OR LANDSCAPING DAMAGED WITHIN THEDESIGNATED ACCESS AREAS AFTER THE COMPLETION OF THE WORK.6. THE LAKE CONTRACTOR SHALL MAINTAIN A CURRENT, COMPLETE AND ACCURATE RECORD OF ALL CHANGES WHICH DEVIATE FROM THE CONSTRUCTION AS PROPOSED IN THESE PLANS ANDSPECIFICATIONS FOR THE PURPOSE OF PROVIDING THE LAKE ENGINEER WITH A BASIS FOR RECORD DRAWINGS. NO CHANGES SHALL BE MADE WITHOUT PRIOR APPROVAL OF THE OWNER'S REPRESENTATIVEAND THE LAKE ENGINEER. IN THE EVENT THAT THE CONTRACTOR NOTICES IRREGULARITIES IN THE LINE OR GRADE HE SHALL BRING IT TO THE IMMEDIATE ATTENTION OF THE LAKE ENGINEER AND THE OWNER'SREPRESENTATIVE FOR A PROPER RESOLUTION. IF HE FAILS TO DO SO, THE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY ERROR IN THE GRADE AND NECESSARY RECONSTRUCTION TO CORRECT SUCH ERROR.7. THE LAKE CONTRACTOR AGREES THAT IN ACCORDANCE WITH GENERALLY ACCEPTED CONSTRUCTION PRACTICES THE LAKE CONTRACTOR SHALL WORK WITH THE OWNER TO PROVIDE FOR THE GOODCONDITION OF THE JOB SITE DURING THE COURSE OF CONSTRUCTION FOR THE PROJECT INCLUDING THE SAFETY OF ALL PERSONS AND PROPERTY AND THAT THIS REQUIREMENT SHALL BE MADE TO APPLYCONTINUOUSLY AND NOT BE LIMITED TO NORMAL WORKING HOURS.8. NEITHER THE OWNER, NOR THE LAKE ENGINEER WILL ENFORCE SAFETY MEASURES OR REGULATIONS AS THEY PERTAIN TO THE LAKE CONTRACTOR. THE LAKE CONTRACTOR SHALL DESIGN, CONSTRUCTAND MAINTAIN ALL SAFETY DEVICES, INCLUDING SHORING AND SHALL BE SOLELY RESPONSIBLE FOR CONFORMING TO ALL LOCAL, STATE AND FEDERAL SAFETY AND HEALTH STANDARDS, LAWS ANDREGULATIONS. THE LAKE CONTRACTOR SHALL PROVIDE TO THE OWNER, PRIOR TO THE START OF WORK, WORKER'S COMPENSATION INSURANCE, PRODUCTS AND COMPLETED OPERATIONS INSURANCE ANDCOMPREHENSIVE LIABILITY INSURANCE CERTIFICATES.IMPORTANT!! BECAUSE OF THE UNCERTAINTY OF THE VOLUME OF ORGANICS ON THE BOTTOM OF THE LAKE, IT IS IMPOSSIBLE TO BE ACCURATE WITH THE GRADING QUANTITIES. IT IS THE INTENT OFTHE OWNER AND THE LAKE ENGINEER THAT THE ORGANIC MATERIAL BE MIXED WITH THE EXISTING SOIL BENEATH THE ORGANICS IN SUCH A MANNER SO AS TO MAKE IT SUITABLE FOR THE SUBGRADE BENEATHTHE LAKE LINER. THE LAKE SIZE AND SHAPE AS DEPICTED HERE SHALL BE ADJUSTED IN THE FIELD SO THAT NO IMPORT OR EXPORT OF MATERIAL IS REQUIRED. THE OWNER SHALL DETERMINE THOSE AREAS TORECEIVE LESS OR MORE FILL AS REQUIRED TO BALANCE THE MATERIAL.FREEBOARDELEV. PERSHORELINEDETAILLAKE WATERSURFACE EL.PER PLAN6"6'-0" APPROXIMATELYLAKE - WIDTH VARIES PER PLANLAKE SHORELINESHOWNONPLAN"LAID BACK" SHORELINEAS SHOWN PER DETAIL.ALK3.1SEAL EQUALIZER PIPETO SHORELINE ASSHOWN ON THE LINERDETAIL .ALK3.32'-0"(MINIMUM)LAKE 162-1/2" dia.6"3'-8"8"6" (MIN.)AIR GAPPOND BOTTOMSURFACE ANDSHORELINE FINISHSURFACETREATMENT SHALLBE AS CALLED OUTON SHORELINEDETAIL (TYPICAL)CONCEAL FILL PIPE WITH PLANTING ANDROCKS - SEE PLAN VIEWPAINT ALL EXPOSED PIPELINES BLACK INCOLOR TO CONCEAL2"dia. SCH 40 PVCEQUALIZER PIPELINESIZE SCH 40 PVC DISCHARGE PIPE PERLEVEL CONTROL TABLE2"dia. SCH 40 PVCEQUALIZER PIPEMECHANICAL LEVELCONTROL VALVE BOXPLASTIC VALVE BOX PER "CARSON" 24SERIES OR ENGINEER APPROVED EQUALWITH BOLT-DOWN LIDCONTACT:(www.oldcastleinfrastructure.com)MECHANICALLEVEL CONTROL VALVEVALVE PER "CLA-VAL" MODEL#124-14 FLOATACTUATED LAKE LEVEL CONTROL VALVEWITH CLASS 150 STEEL BODY ANDTHREADED ENDS, #304 S.S VALVE TRIM ANDBUNA N SYNTHETIC RUBBER PARTS -IMPORTANT!!! THIS VALVE ISDESIGNED TO OPEN ONLY WHENSUFFICIENT PRESSURE IS AVAILABLE FROMTHE IRRIGATION STATION SYSTEM MAIN LINE- SET TO OPEN ONLY ABOVE 88 PSI (VERIFY)- USE #X102A THROTTLING SYSTEM300S-20-200 @ 88psiCONTACT: www.cla-val.comLINESIZE BRONZEGATE VALVECONCEAL VALVEBOX w/ PLANTING(BY OTHERS)LINESIZE SCH 80 PVC SLIP / THREADADAPTOR WITH S.S. STRAP ANDTHREAD END (TYPICAL (2) PLACES)ADD PEA GRAVEL UNDER MECHANICALLEVEL CONTROL VALVE BOX FORDRAINAGELAKE FILL PIPE FROMDOMESTIC WATER SOURCEIMPORTANT!!ALL PVC INSIDE MECHANICAL LEVELCONTROL VALVE BOX SHALL BE SCH 80- ALLPIPE OUTSIDE THE VALVE BOX SHALL BESCH 40 (TYPICAL)USE 10"dia. 100 PSI P.I.P. PIPE ASSHOWN FOR STILLING WELL10" x 2" SCH 40PVC SADDLE10" 100 PSI P.I.P.PIPE CAP2'-6"USE GROUTED ROCK TO PREVENT EROSIONWHEN FILLING1'-0"(MIN.)SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:1" = 1'-0"SCALE:1/2" = 1'-0"La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 525 +5+0-5-10+6+4+3+2+1-1-2-3-4-8-6-7-9+5+0-5-10+6+4+3+2+1-1-2-3-4-8-6-7-9+7+8+9+10+11+12+7+8+9+10+11+126'-0"(APPROX.)LAKE - WIDTH VARIES PER PLANSHORELINESHOWN ONLAKE PLAN4'-0"(MIN.)LAKE WATERSURFACEELEVATIONPER PLANLAKE LINERELEVATION PERPLANDEPTH PER PLANEQUAL APPROX.(SEE LAKE PLAN)EQUAL APPROXIMATELY (SEE LAKE PLAN)AERATIONDIFFUSERAS SHOWNPERBLK4.2AERATIONVALVE BOXAS SHOWNPERALK4.2LAID BACK SHORELINETREATMENT PERRUN NON-PERFORATED WEIGHTED HOSE IN 2"dia. SCH 40 PVCSLEEVE - CUT HOLE IN VALVE BOX TO FIT OUTSIDE DIAMETEROF SLEEVE - DO NOT USE FITTINGS IN SLEEVE OTHER THANLONG SWEEP FITTINGS TO AVOID CRIMPING IN WEIGHTED HOSE- WEIGHTED HOSE TERMINATES AFTER HOSE EXITS CONCRETEVENEER AT A MINIMUM OF 3'-0" DEPTH3/4"dia. WEIGHTED HOSE PERDIFFUSER MANUFACTURERFILL THIS SPACE SOLIDWITH CONCRETELIMIT OF LAKE LINERBEYONDAERATIONSYSTEMPIPINGWHERESHOWN ONLAKE PLANALK3.1ALTERNATEDIFFUSERTHE LAKECONTRACTOR SHALLBID AN ALTERNATE TOTHIS DIFFUSER ASSHOWN ON DETAILBLK4.2WHERE EARTH COVEROCCURS ABOVE LINERSET DIFFUSER ATOPEARTH COVERMATERIAL (TYPICAL)Note:FOR ALTERNATE LINER SUBGRADE TREATMENTS(NOT SHOWN HERE) SEE DETAILALK2.1Aeration System Notes1. THE AERATION EQUIPMENT SYSTEM SHOWN ON THESEPLANS SHALL BE OF THE SINGLE-PISTON COMPRESSOR TYPECAPABLE OF PROVIDING A MINIMUM OF TEN (10) TURNOVERSOF THE ENTIRE LAKE SYSTEM VOLUME IN A 24-HOUR PERIOD.THE SYSTEM SHALL BE AS MANUFACTURED BY E.P. AERATIONOF SAN LUIS OBISPO, CALIFORNIA OR LAKE ENGINEERAPPROVED EQUAL. THE SYSTEM SHALL INCLUDE (2) 1/3hpCOMPRESSORS WITH ALL APPLICABLE ELECTRICALCOMPONENTS AND ACCESSORIES IN EACH CABINET. THEPOWER REQUIREMENTS FOR EACH CABINET IS . . . . . . 120vac,SINGLE PHASE, 18 AMPS. EACH CABINET SHALL BE MOUNTEDTO THE CONCRETE WALL AS SPECIFIED BY THE SYSTEMMANUFACTURER. THE AERATION CABINET SHALL BESUPPLIED WITH A 120v. SINGLE PHASE POWER CABLE WITHPLUG AS SHOWN.2. THE AERATION SYSTEM EQUIPMENT INCLUDESCOMPRESSORS ONLY..... NO OZONE!!THE AERATION SYSTEM MANUFACTURER SHALL PROVIDEPRODUCT CUT SHEETS AND SHOP DRAWINGS IN AUTOCADFORMAT TO THE LAKE ENGINEER FOR APPROVAL PRIOR TOPROVIDING PRICING TO THE LAKE CONTRACTOR. THE LAKEENGINEER SHALL DETERMINE IF THE AERATION EQUIPMENTSUPPLIED BY THE AERATION MFR IS SUITABLE FOR THISPROJECT.3. THE AERATION SYSTEM SUPPLIER SHALL PROVIDE AS APART OF HIS SYSTEM (6) SETS OF OPERATIONS ANDMAINTENANCE MANUALS WHICH CLEARLY DESCRIBE THEMAINTENANCE AND REPAIR OF EACH COMPONENT OF THESYSTEM. THE MANUALS SHALL BE 8-1/2 X 11 FORMAT BOUNDAND SHALL CONTAIN MANUFACTURER'S SHOP DRAWINGS,MATERIALS LISTS WITH SOURCES AND BOTH WRITTEN ANDGRAPHIC DESCRIPTIONS OF ALL MONTHLY, QUARTERLY ANDYEARLY MAINTENANCE PROCEDURES FOR ALL COMPONENTSOF THE SYSTEM. THE MANUFACTURER SHALL ALSO INCLUDEA TRIP TO THE SITE AFTER INSTALLATION FOR SYSTEMSTART-UP AND FOR 6-HOURS OF ON-SITE TRAINING OF THEPROJECT MAINTENANCE STAFF IN THE OPERATION ANDMAINTENANCE OF THE AERATION SYSTEM.Panel Mounting:L2x2x1/4 VERT. MOUNTED PANEL SUPPORTS SPACED TO FITTHE AER'N PANEL MOUNTING BRACKETS - CONNECT PANELTO SUPPORTS WITH STAINLESS STEEL BOLTS NUTS ANDWASHERS TO SIZE SPECIFIED BY AERATION SYSTEM PANELMANUFACTURER - SUPPORTS SHALL BE HOT-DIP GALVANIZEDPRIOR TO INSTALLATIONNote!!PANEL SHALL BEDESIGNED FOROUTDOOR USE(TYPICAL)PER VAULT DETAILPER AERATIONCABINET MFR'SSHOP DRAWINGSCAERATIONCABINET2"dia.2"dia.PERVAULTDETAIL1"dia. BALL TYPEHOSE BIBB(NORMALLYCLOSED) TOALLOW FORDRAINAGE OFCONDENSATEISOLATION VALVEWITH INLINECHECK VALVE ASSUPPLIED BY THEAERATIONMANUFACTURERPRESSURE GAUGEAS SUPPLIED BYTHE AERATIONSYSTEM MFR (ONEPER COMPRESSOR)LINESIZE SCH40PVC PIPE ANDFITTING (TYP.)CLAMP AERATIONPIPES TO WALLWITH PRE-FAB PIPECLAMPS PER(TYPICAL)LK4.3AAERATION DISCH.PIPELINE TO VALVE ATLAKE EDGE WHERESHOWN ON PLAN VIEWPER DETAILLK4.2ALINESIZE TRU-UNION BALL VALVEIS NORMALLYOPENLINESIZE PVCSWING CHECKVALVE PER "FLO"SERIES 1520SOLVENT WELD TOSIZE SHOWN4 PLEX GFCIPROTECTED110v. OUTLETFROM SITEELECTRICALBY OTHERSPERVAULT DETAILSEAL AERATION PIPE TOCONCRETE FLOOR ASSHOWN ON PUMPSTATION DRAWINGSADJACENTCABINET WHEREOCCURS2'-0"SPACE BETWEENCABINETS(TYPICAL)2"dia.AERATIONDISCHARGE WHENIN VAULT (TYP)SEE VAULT DETAILFOR SPACINGBETWEEN CABINETSWHEN IN VAULTPERVAULTDETAILMultiple Cabinets Mounted on Interior WallExterior Mounted Cabinet(feet provided by mfr)View Inside AerationCabinet (2 compressors)SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.com1" = 1'-0"SCALE:3/8" = 1'-0"SCALE:La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202503-28-202503-28-2025Page 526 1'-0" MIN.CPIPETRENCH WIDTHPER DETAILLK4.3BLENGTH TOFIT REQ'DBLOCK AREATEEELBOW C A PWIDTH TOFIT REQ'DBLOCK AREALENGTH TOFIT REQ'DBLOCK AREAWIDTH TOFIT REQ'DBLOCK AREAWIDTH TOFIT REQ'DBLOCK AREALENGTH TOFIT REQ'DBLOCK AREATYPICAL SECTIONGENERAL NOTES1. TABLE IS BASED ON 2000l /ft SOIL BEARINGALLOWANCE. IF CONDITIONS ARE FOUND TOINDICATE SOIL BEARING IS LESS, THE AREASSHALL BE INCREASED ACCORDINGLY.2. AREAS FOR PIPE LARGER THAN 18"dia. SHALL BECALCULATED.3. CONCRETE SHALL HAVE A MINIMUMCOMPRESSION STRENGTH OF 2000psi.4. THRUST BLOCK IS TO EXTEND TO UNDISTURBEDSOIL.5. SIZE MAY BE DECREASED FOR LESSER DEGREEBENDS AS DETERMINED BY THE ENGINEER.6. KEEP CONCRETE CLEAR OF BELL AND SPIGOTJOINTS.7. BLOCK IN SIMILAR MANNER AT TEES, HYDRANTS,PLUG OR OTHER LOCATIONS AS REQUIRED8. IF CONCRETE BLOCKS CANNOT BE POURED,THEN USE TIE-RODS OR OTHER APPROVEDMETHOD TO RESTRAIN THRUSTPIPESIZEWATER PIPETEE, CAP,90 BENDS45 & 22.5BENDS3 FT4 FT6 FT9 FT 5 FT7 FT12 FT15 FT13 FT23 FT29 FT4" & LESS6"8"10"12"16"18"THRUST BLOCK AREAREQUIREMENTSNOTE:CONTRACTOR SHALLPROVIDE THRUST BLOCKSFOR ALL IN GROUNDPIPING 4"dia. AND LARGER3 FT3 FT3 FTAROUND4" MIN.ALLBox Color:USE GREEN COLORED BOX INGRASS AREAS AND LIGHT BROWNCOLORED BOX IN SOIL AREAS"CARSON" MODEL910-2B BOLT DOWNLID"CARSON" PLASTICVALVE BOX MODEL#910-1CUT HOLE IN BOX BOTHENDS TO FIT OUTSIDEDIAMETER OF PIPELINE1"dia. PVC BALL VALVE PER"HAYWARD" SAFE BLOCKTRUE UNION WITH UNIONFITTINGS BOTH ENDSINTEGRAL1" LONG X 1"dia. PVCNIPPLE1" X 1/2"dia. PVCREDUCERCONNECT WEIGHTEDAERATION HOSE TOREDUCER WITH S.S.CLAMP - RUN WEIGHTEDHOSE IN 2"dia. PVCSLEEVE TO LAKE (NOTSHOWN HERE)RUN NON-PERFORATEDWEIGHTED HOSE PER"HINDE" OR APPROV.EQ. TO AERATION DISKIN LAKE BOTTOMBACKFILL AGAINSTBOX WITH "CLEAN"BACKFILL OR SANDPROVIDE 4" (MIN.) THICKLAYER OF GRAVEL ORCRUSHED ROCK ASSHOWN AS DRAIN2'-0"APPROX.3'-0" WIDE5'-0" LONG4'-0" APPROX.2'-0" APPROX.3/4" THICK PVC PLATE - ATTACH TOUNDERSIDE OF EACH LEG WITH 2"LONG STAINLESS STEEL SCREWSCONNECT WEIGHTED HOSE TODIFFUSER STUB-OUT HEREALTERNATE DIFFUSERTHE LAKE CONTRACTOR SHALL BID THISDIFFUSER AS AN ALTERNATE TOTHOSE DIFFUSERS SHOWN ON PLANCONNECT WEIGHTED HOSE ATOTHER END TO VALVE IN VALVEBOX WHERE SHOWN ON PLAN VIEWInformation and Sales Contact:www.bioboost.cajody@bioboost.cadavid@bioboost.caph: 905-830-5555 fax: 905-830-55259" MIN.4"MIN.6"MIN.4" MIN.CLEARCPIPECPIPE9" MIN.4"MIN.TRENCH WIDTHTO FIT PIPE SIZES4" MIN.CLEARCPIPECOMPACTED NATIVESOIL (ROCK FREE)COMPACTED NATIVESOIL (ROCK FREE)4" MIN.CLEAR4" MIN.CLEARTRENCH - SINGLE PIPETRENCH - MULTIPLE PIPEBANOTE: TRENCH BACKFILLSHALL CONFORM TO ASTMD2321 UNLESSOTHERWISE APPROV. BYTHE WATERFEATUREENGINEERNote:4" MIN. THICK SAND FOUNDATIONREQUIRED WHERE EXCAVATEDTRENCH BOTTOM CONSISTS OF SHARPEDGES OR RIDGES OR HAS HIGHPOINTS OF LOCALIZED LOADINGSWHICH MAY PUNCTURE THE PIPE ASDETERMINED BY THE WATER FEATUREENGINEER IN THE FIELDTOTAL TRENCH DEPTHBACKFILL SHALL OCCUR IN 6"LIFTS AND SHALL BECOMPACTED TO 90% RELATIVECOMPACTION (ALL TRENCHES)TRENCH WIDTHTO FIT PIPE SIZESSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comNONESCALE:NONESCALE:1-1/2" = 1'-0"SCALE:NONESCALE:La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 527 Pump Station Notes:1. THE TRANSFER SYSTEM PUMP(S) SHALL BE PER MODEL, SIZE, HORSEPOWER, ETC.SHOWN ON THE "PUMP LIST" ON THIS DETAIL. THE PUMP SHALL BE VERTICALLYMOUNTED ON A PRE-FAB SCREENED STEEL BASE INCLUDING STEEL THREADEDDISCHARGE SUPPLIED BY THE PUMP MFR. THE PUMP SHALL BE LOOSELY SET ON THEFLOOR OF THE VAULT AS SHOWN.2. THE LAKE CONTRACTOR SHALL INCLUDE AS A PART OF THE PUMP STATION WORK,ELECTRICAL HOOK-UP OF ALL ELECTRICAL COMPONENTS INSIDE THE PUMP STATIONAS DEPICTED ON THIS DETAIL. THE WORK SHALL BE PREFORMED IN ACCORDANCEWITH THE N.E.C. AND LOCAL CODES AND ORDINANCES AND BY A QUALIFIED LICENSEDELECTRICAL CONTRACTOR.3. ALL PVC PIPE SHOWN ON THIS SHEET SHALL BE SCH40 PVC OR BETTER WITH MFRPROVIDED SOLVENT WELD FITTINGS UNLESS OTHERWISE SHOWN OR UNLESSOTHERWISE SUPPLIED BY THE MANUFACTURER OF THE MATERIALS.4. THE PUMPS, CONTROLS AND PIPE FITTINGS SHOWN ON THIS DETAIL SHALL BECONSTRUCTED BY A LAKE CONSTRUCTION COMPANY FAMILIAR WITH THIS TYPE OFPUMP AND SYSTEM CONTROLS AND SHALL INCLUDE PUMPS, VALVES, FITTINGS,CONTROLS, WIRING AND ELECTRICAL HOOK-UP TO MAKE A COMPLETE ANDOPERATIONAL TRANSFER PUMP SYSTEM CAPABLE OF DELIVERING THE FLOWS ATTHE PRESSURE INDICATED ON THESE PLANS. THE PRE-FAB PUMP VENDOR SHALLPREPARE SHOP DRAWINGS FOR APPROVAL BY THE LAKE ENGINEER PRIOR TO STARTOF PUMP FABRICATION. SHOP DRAWINGS AND SUBMITTALS SHALL INCLUDE DATACUT SHEETS FOR ALL COMPONENTS AND A STRUCTURAL DRAWING FOR PUMPMOUNTING.5. THE PUMP STATION WET WELL SHALL BE PRE-FABRICATED POLYETHYLENE WITHGRADE RING AND GRATE COVER AS REQUIRED TO ACHIEVE THE INSIDE HEIGHTDIMENSION SHOWN. THE WET WELL, GRADE RING, GRATE COVER AND LATERAL PIPECONNECTION SHALL BE PER "ADS NYOPLAST" OR LAKE ENGINEER APPROVED EQUAL.CONTACT: PH: 770-632-2443, www.adspipe.com.THE CONTRACTOR SHALL INCLUDE:A. PRE-FAB GRATE COVER CUT TO FIT OPENING SHOWN. THE GRATE SHALL BESET IN A SINGLE PIECE WITH A SLOT CUT TO RECEIVE THE DISCHARGE PIPE.THE GRATE SHALL BE BOLTED DOWN TO THE TOP OF THE WET WELL USING THEBOLT-DOWN ADAPTER PROVIDED BY THE GRATE MANUFACTURER.B. PIPE CONNECTION HOLES AT EACH PIPE PENETRATION WITH A DIAMETEREQUAL TO THAT SHOWN ON THIS PLAN AND FITTED WITH A MANUFACTURERSUPPLIED SLEEVE TO CONNECT TO THE PIPE SHOWN.C. KNOCKOUTS OR HOLES TO RECEIVE THE ELECTRICAL CABLE TO SUPPLYPOWER TO THE PUMP WHERE CALLED FOR ON THIS DETAIL.THE WET WELL VENDOR SHALL PREPARE SHOP DRAWINGS FOR THE WET WELL,GRATE, GRATE SUPPORT AND LATERAL PIPE CONNECTION FOR APPROVAL BY THELAKE ENGINEER PRIOR TO FABRICATION.6. ALL MFR'S PRODUCT CALLOUTS SHOWN ON THESE PLANS SHALL BE CONSIDERED"OR LAKE SYSTEM ENGINEER APPROVED EQUAL" UNLESS OTHERWISE NOTED. THELAKE SYSTEM CONTRACTOR SHALL SUBMIT MFR'S PRODUCT DATA SHEETS FORAPPROVAL BY THE LAKE SYSTEM ENGINEER PRIOR TO ORDERING MATERIALS.7. THESE DRAWINGS REPRESENT THE FINISHED FACILITY, THEY DO NOT INDICATETHE METHOD OF CONSTRUCTION. THE LAKE SYSTEM CONTRACTOR SHALL PROVIDEALL MEASURES NECESSARY TO PROTECT THE SURROUNDING FACILITIES DURINGCONSTRUCTION. SUCH MEASURES SHALL INCLUDE, BUT NOT LIMITED TO, BRACING,SHOREING, ETC. FOR LOADS DUE TO CONSTRUCTION EQUIPMENT, ETC.LAKEWATERSURFACEEL. +353.00LAKELINER EL.+344.00(VERIFY)7'-6 5/16"16'-5 3/8"PIPE INV.EL.+345.50(VERIFY)1'-9"WETWELLFIN.FLOOREL.+343.75(VERIFY)6'-0"2'-6"1'-8"1'-8"1'-0"5'-2"1'-4"TOP OFWET WELLEL. +360.20(VERIFY)7'-2 3/8"FLOW 6"dia.8"dia.FLOW8"dia. DISCHARGE PIPETO LOCATION SHOWNON PLAN VIEWLAKEPump List....PUMPSERVICE MANUFACTURER / MODEL # CAPACITY HP TURBINE# PH/VOLTS/HZTRANS-FER575gpm@ 35' tdh10CP06-160-1 1/240/60CARRY PUMPS STAINLESS STEELSUBMERSIBLE VERTICAL TURBINEFLOW PUMP MODEL#CP06-0100-231-T5'-3"3'-3"1'-4"8'-2"2'-6" WET WELL1'-8"1'-0"EQUALEQUAL5'-3"3'-3"8'-2"2'-11"3'-3"8'-2"2'-6" WET WELL1'-8"1'-2"WETWELLWETWELLWETWELLFLOWSecPump Station Plan ViewPump Station Cross SectionPump Curve & DimensionsUNDER-DRAIN1'-6"MODEL NOTESMANUFACTURERSYMBOL# ITEM TYPE12345678CHECKVALVECHECKVALVEBUTTERFLYVALVEBALLVALVE90deg ELLREDUCERBUSHINGWAFER TYPE E.I. &BRONZE EPDM SEATSCH 80 SPRINGLOADEDWAFER TYPE E.I. &BRONZE EPDM SEATSCH 80 PVC - COMPRFITTINGS BOTH ENDSSCH 80 PVC SOLVENTWELDTUFSKIN, INC.www.universalsales.bizSEKISUI IND. PIPINGwww.si-valve.comTUFSKIN, INC.www.universalsales.bizSEKISUI IND. PIPINGwww.si-valve.comDURAwww.duraflow.comCV SERIESITEM #CKBS SERIESITEM #80SIZE SHOWN w/ S.Snuts, bolts & washersSOLVENT WELD,BUNA-N, seal per planSIZE SHOWN w/ S.Snuts, bolts & washersSIZE SHOWN, inf.adjust, plastic handleUSE MFR RequiredPrimer, Solvent WeldFittings List . . . .SCH 80 PVC SOLVENTWELDDURAwww.duraflow.comUSE MFR RequiredPrimer, Solvent WeldSLIP / FLGADAPTERSCH 80 PVC - BOLT /SOLVENT WELDDURAwww.duraflow.comUSE MFR RequiredPrimer, Solvent WeldEQUALEQUALEQ.EQ.FLOWWET WELL INTAKEPIPE FROM LAKE(LINESIZE PER PLAN)65 m3/hr(285gpm) @ 5m(16.5') tdh3VFDREQ'D1/240/60CARRY PUMPS STAINLESS STEELSUBMERSIBLE VERTICAL TURBINEFLOW PUMP MODEL#CP04-0300-231-T3'-9"MIN. SUBMERGENCELake#16BAWET WELL INTAKEPIPE FROM LAKE(LINESIZE PER PLAN)8"dia.SEAL INTAKE PIPE TO WET WELLWALL WITH COLLAR PROVIDEDBY THE WET WELL MFRTRANSFER PUMP AS CALLEDOUT ON TABLE (THIS DETAIL) -SET LOOSELY ON WET WELLFLOORBOLT DOWN COVERGRATE PROVIDED BYTHE WET WELL MFR -CUT U-SHAPED SLOTTO RECEIVEDISCHARGE PIPETRANSFER PUMP CONTROLPANEL AS PROVIDED BY THEPUMP MANUFACTURER8"dia.CONCRETE SLAB ASDETAILED ON CROSSSECTION (THISDETAIL)DASHED LINEINDICATESREQUIRED CLEARSPACE IN FRONT OFPUMP STATIONCONTROL PANEL PERCODETRANSFER SYSTEMPUMP CONTROLPANEL AS PROVIDEDBY THE PUMPMANUFACTURERAIR RELEASE VALVEPER DETAILLK6.1D6"THICK CONCRETESLAB (F'C = 2500PSIMINIMUM)REINFORCED WITH#4 BARS @ 300MM(12") O.C. EACH WAYTRANSFER PUMP ASCALLED OUT ONTABLE (THIS DETAIL) -SET LOOSELY ONWET WELL FLOORUSE LINESIZE SCH80PVC SLIP / THREADCOUPLING TOCONNECTDISCHARGE PIPE TOPUMP DISCHARGEUSE LINESIZE SCH80PVC DISCHARGE PIPERISERCONCRETE COLLAR(F'C = 2500PSIMINIMUM)REINFORCED WITH#4 BARS @ 12" O.C.EACH WAY TO SIZEAND CONFIGURATIONSHOWNWET WELL AS DESCRIBED IN PUMPSTATION NOTES - THE WET WELL WILLBE FABRICATED IN SECTIONS WITHCONNECTOR COUPLINGS SUPPLIED BYTHE VENDOR - CONTACT VENDOR FORSPECIFIC GUIDELINES FORINSTALLATION REQUIREMENTSWRAP GRAVELBACKFILL WITH ASINGLE LAYER OF 8OZ/SY GEOTEXTILEFABRIC ALL AROUNDWET WELLIF PIPE SIZE SHOWNON PLAN IS LARGERTHAN SHOWN HEREUSE REDUCERBUSHING TO MATCHAT THIS LOCATION(TYPICAL)8"dia. DISCHARGE PIPETO LOCATION SHOWNON PLAN VIEWWATERTIGHT BOTTOMSEAL PROVIDED BY THEWET WELL MFRSEAL INTAKE PIPE TOWET WELL WALL WITHCOLLAR PROVIDED BYTHE WET WELL MFRRUN POWER CORD TOCONTROL PANEL PERPUMP MANUFACTURER'SREQUIREMENTSBOLT DOWN COVERGRATE PROVIDED BYTHE WET WELL MFR -CUT U-SHAPED SLOT TORECEIVE DISCHARGEPIPETHE GRAVEL BACKFILLMATERIAL SHALL BECRUSHED STONE OROTHER GRANULARMATERIAL MEETING THEREQUIREMENTS OFCLASS II MATERIAL PERASTM D2321 - PLACEUNIFORMLY COMPACTEDTO 90% STANDARDDENSITY 6"dia.58"dia.757175ACCEPTABLEMOUNTING LOCATIONFOR AERATIONCABINET - SEE PLANFOR QUANTITYACCEPTABLEMOUNTING LOCATIONFOR AERATIONCABINET - SEE PLANFOR QUANTITYSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.com3/4" = 1'-0"SCALE:La Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 528 CLPIPEPIPE BOOT OF THE SAMEMATERIAL AS THE MEMBRANELINER TO BE PRE-FAB-RICATED BY THE LINERMFR - SEE DETAILCLEARINTAKE PIPEINVERT ELEV.PER PLANWATER SURF. EL.PER PLANLK3.3 - INTAKE PIPE TO SIZE AND WHERELOCATED ON PLAN VIEW - EXTENDPIPE THRU LINER AND EARTHCOVER AS SHOWN TO SUPPORT SCREENPRE-FABRICATED STEEL BOXSCREEN SUPPORTED ON ENDOF INTAKE PIPE AS SHOWNON DETAIL SEE PLANFOR MORE INFORMATIONB-LAKE MEMBRANE LINER WITH PROTECTIVE COVERAS DESCRIBED IN LAKE SYSTEM GENERAL NOTESINTAKE PIPETO PUMP STATIONAS SHOWN ONPLAN VIEWCAREFULLY PREPARED LINERSUBGRADE AS DESCRIBED INLAKE SYSTEM GENERAL NOTES6"6"CL'R.6"2"EQUALEQUALEQUALEQUALTO FIT PIPE SIZESHOWN ON PLAN2'-0"2'-0"2'-0"3/16" THICK STEEL PLATE ONSCREEN TOP, BOTTOM ANDAT CONNECTION TO PIPE -WELD ALL EDGECONNECTIONSL1-1/4 X 1-1/4 X 1/8STEEL POSTSINSIDE OF SCREENAT TWO FRONTCORNERS OFTHIS ASSEMBLY1/2" EXPANDEDWIRE MESH(3) SIDES ASSHOWN - WELDALL EDGESTO POSTS ANDSTEEL PLATEEDGESL1-1/2 x 1-1/2 X 1/8STEEL FRAMEAT PERIMETEROF ALL SCREENEDOPENINGS -WELD TO STEELPLATES ANDTO EACH OTHERAT ENDS - ALLENDS SHALLBE MITEREDSTEEL PIPE SLEEVESIZED TO FIT THIS OUT-SIDE DIAMETER OF THEINTAKE PIPE SHOWN ONTHE PLAN VIEWDRILL 3/4"dia. HOLEIN TOP OF SLEEVEAND TOP OF INTAKEPIPE - LOCK SCREENTO PIPE WITH LOOSE5/8"dia. S.S. PINALL WELDED EDGES SHALLBE GROUND SMOOTH AND THISENTIRE ASSEMBLY SHALL BEHOT DIP GALVANIZED AFTERFABRICATIONNote:ExistingPVCNew RPENew TITUSINDUSTRIALG-25 Tapeper specsbelowcenter tapeon this edge4" to 6"overlapAIR RELEASE VALVEBRONZE COVER PETCOCK PER"GRAINGER" ITEM# 5MYW1CONTACT:www.grainger.com/productAIR RELEASE VALVE SAMPLEPHOTODISCHARGE PIPETO SIZE SHOWNON PLANSCH 40 PVCSOLVENT WELDSADDLE (25mm(1") dia. xLINESIZE)SCH 40 PVCSOLVENT WELDREDUCERBUSHING (TOFIT VALVE)SCH 80 PVCCLOSE NIPPLE(TO FIT VALVE)AIR RELEASEVALVE - SEE AIRRELEASE VALVENOTE ON THISDETAIL FORMORE INFOSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:NONESCALE:NONESCALE:NONELa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-2025Page 529 LA RINCONADA COUNTRY CLUB REDESIGN CONSTRUCTION EMISSIONS & HEALTH RISK ASSESSMENT Los Gatos, California February 7, 2025 Prepared for: Patrick Kallas Project Manager David J. Powers & Associates, Inc 1871 The Alameda, Suite 200 San José, CA 95126 Prepared by: Zachary Palm Jordyn Bauer 429 East Cotati Avenue Cotati, CA 94931 (707) 794-0400 I&R Project#: 25-007 Page 530 Introduction The purpose of this report is to address the potential construction air quality and health risk impacts associated with the redesign of the existing La Rinconada Country Club Golf Course located at 14595 Clearview Drive in Los Gatos, California. Air quality impacts would be associated with the restoration of the golf course and relocation of one of the holes. Air pollutant emissions associated with construction of the project were estimated using appropriate computer models. In addition, the potential project health risks and the impact of existing toxic air contaminant (TAC) sources affecting the nearby sensitive receptors were evaluated. The analysis was conducted following guidance provided by the Bay Area Air Quality Management District (BAAQMD).1 Project Description The approximately 87.67-acre project site is the La Rinconada Country Club. The project proposes restoring seventeen of the eighteen golf holes, modernizing the irrigation and drainage systems, replace the fairway grass, and replace most of the existing golf course cart paths with reduced footprint cart paths. The only hole location that would be modified would be the 13th hole, which would move from the edge of the project site to an internal location on the south side of the project site. No new or renovated structures are proposed. Construction is proposed to begin in late March of 2026 and be completed by September 2026. Setting The project is located in Santa Clara County, which is in the San Francisco Bay Area Air Basin. Ambient air quality standards have been established at both the State and federal level. The Bay Area meets all ambient air quality standards with the exception of ground-level ozone, respirable particulate matter (PM10), and fine particulate matter (PM2.5). Air Pollutants of Concern High ozone concentrations in the air basin are caused by the cumulative emissions of reactive organic gases (ROG) and nitrogen oxides (NOX). These precursor pollutants react under certain meteorological conditions to form ozone concentrations. Controlling the emissions of these precursor pollutants is the focus of the Bay Area’s attempts to reduce ambient ozone concentrations. The highest ozone concentrations in the Bay Area occur in the eastern and southern inland valleys that are downwind of air pollutant sources. High ozone concentrations aggravate respiratory and cardiovascular diseases, reduced lung function, and increase coughing and chest discomfort. Particulate matter is another problematic air pollutant in the air basin. Particulate matter is assessed and measured in terms of respirable particulate matter or particles that have a diameter of 10 micrometers or less (PM10) and fine particulate matter where particles have a diameter of 2.5 micrometers or less (PM2.5). Elevated concentrations of PM10 and PM2.5 are the result of both region-wide (or cumulative) emissions and localized emissions. High particulate matter 1 Bay Area Air Quality Management District, 2022 CEQA Guidelines, April 2023. Page 531 concentrations aggravate respiratory and cardiovascular diseases, reduce lung function, increase mortality (e.g., lung cancer), and result in reduced lung function growth in children. Toxic Air Contaminants TACs are a broad class of compounds known to cause morbidity or mortality, often because they cause cancer. TACs are found in ambient air, especially in urban areas, and are caused by industry, agriculture, fuel combustion, and commercial operations (e.g., dry cleaners). TACs are typically found in low concentrations, even near their source (e.g., diesel particulate matter [DPM] near a freeway). Because chronic exposure of TACs can result in adverse health effects, they are regulated at the regional, State, and federal level. Diesel exhaust is the predominant TAC in urban air and is estimated to represent about three- quarters of the cancer risk from TACs (based on the Bay Area average). According to the California Air Resources Board (CARB), diesel exhaust is a complex mixture of gases, vapors, and fine particles. This complexity makes the evaluation of health effects from diesel exhaust exposure a complex scientific issue. Some of the chemicals in diesel exhaust, such as benzene and formaldehyde, have been previously identified as TACs by the CARB, and are listed as carcinogens either under the State's Proposition 65 or under the Federal Hazardous Air Pollutants programs. Health risks from TACs are estimated using the Office of Environmental Health Hazard Assessment (OEHHA) risk assessment guidelines, which were published in February of 2015 and incorporated in BAAQMD’s current CEQA guidance.2 PM2.5 emissions can include TACs. Due to the adverse health effects caused by PM2.5 exposure even at low concentrations, BAAQMD developed assessing methods and health risk thresholds to address exposure to increased concentrations caused by project PM2.5 emissions.3 Sensitive Receptors There are groups of people more affected by air pollution than others. CARB has identified the following persons who are most likely to be affected by air pollution: children under 16, the elderly over 65, athletes, and people with cardiovascular and chronic respiratory diseases. These groups are classified as sensitive receptors. Locations that may contain a high concentration of these sensitive population groups include residential areas, hospitals, daycare facilities, elder care facilities, and elementary schools. For cancer risk assessments, infants and small children are the most sensitive receptors, since they are more susceptible to cancer causing TACs. Residential locations are assumed to include infants and small children. The closest sensitive receptors to the project site would be located in the adjacent single-family residences surrounding the golf course. Roxbury Elderly Care is located to the west of the project site. There are additional single-family residences surrounding the site at further distances. This project would not introduce new sensitive receptors (i.e., residents) to the area. 2 OEHHA, 2015. Air Toxics Hot Spots Program Risk Assessment Guidelines, The Air Toxics Hot Spots Program Guidance Manual for Preparation of Health Risk Assessments. Office of Environmental Health Hazard Assessment. February. 3 BAAQMD, 2022 CEQA Air Quality Guidelines, Appendix A, p40. Page 532 Bay Area Air Quality Management District (BAAQMD) BAAQMD has jurisdiction over an approximately 5,600-square mile area, commonly referred to as the San Francisco Bay Area (Bay Area). The District’s boundary encompasses the nine San Francisco Bay Area counties, including Alameda County, Contra Costa County, Marin County, San Francisco County, San Mateo County, Santa Clara County, Napa County, southwestern Solano County, and southern Sonoma County. BAAQMD is the lead agency in developing plans to address attainment and maintenance of the National Ambient Air Quality Standards and California Ambient Air Quality Standards. The District also has permit authority over most types of stationary equipment utilized for the proposed project. The BAAQMD is responsible for permitting and inspection of stationary sources; enforcement of regulations, including setting fees, levying fines, and enforcement actions; and ensuring that public nuisances are minimized. BAAQMD’s Community Air Risk Evaluation (CARE) program was initiated in 2004 to evaluate and reduce health risks associated with exposures to outdoor TACs in the Bay Area.4 The program examines TAC emissions from point sources, area sources, and on-road and off-road mobile sources with an emphasis on diesel exhaust, which is a major contributor to airborne health risk in California. The CARE program is an on-going program that encourages community involvement and input. The technical analysis portion of the CARE program has been implemented in three phases that includes an assessment of the sources of TAC emissions, modeling and measurement programs to estimate concentrations of TAC, and an assessment of exposures and health risks. Throughout the program, information derived from the technical analyses has been used to develop emission reduction activities in areas with high TAC exposures and high density of sensitive populations. Risk reduction activities associated with the CARE program are focused on the most at-risk communities in the Bay Area. Seven areas have been identified by BAAQMD as impacted communities. They include Eastern San Francisco, Richmond/San Pablo, Western Alameda, San José, Vallejo, Concord, and Pittsburgh/Antioch. The project site is not located within any of the BAAQMD CARE areas. Overburdened communities are areas located (i) within a census tract identified by the California Communities Environmental Health Screening Tool (CalEnviroScreen), Version 4.0 implemented by OEHHA, as having an overall score at or above the 70th percentile, or (ii) within 1,000 feet of any such census tract.5 The BAAQMD has identified several overburdened areas within its boundaries. However, the project site is not within an overburdened area as the Project site is scored at the 15th percentile on CalEnviroScreen.6 4 See BAAQMD: https://www.baaqmd.gov/community-health/community-health-protection-program/community- air-risk-evaluation-care-program. 5 See BAAQMD: https://www.baaqmd.gov/~/media/dotgov/files/rules/reg-2-permits/2021- amendments/documents/20210722_01_appendixd_mapsofoverburdenedcommunities-pdf.pdf?la=en. 6 OEHAA, CalEnviroScreen 4.0 Maps https://oehha.ca.gov/calenviroscreen/report/calenviroscreen-40 Page 533 BAAQMD CEQA Air Quality Guidelines In June 2010, BAAQMD adopted thresholds of significance to assist in the review of projects under CEQA. In 2023, the BAAQMD revised the California Environmental Quality Act (CEQA) Air Quality Guidelines that include significance thresholds to assist in the evaluation of air quality impacts of projects and plans proposed within the Bay Area. The current BAAQMD guidelines provide recommended procedures for evaluating potential air impacts during the environmental review process consistent with CEQA requirements including thresholds of significance, mitigation measures, and background air quality information. They include assessment methodologies for criteria air pollutants, air toxics, odors, and GHG emissions as shown in Table 1.7 Air quality impacts and health risks are considered potentially significant if they exceed these thresholds. The BAAQMD recommends all projects include a “basic” set of best management practices (BMPs) to manage fugitive dust and consider impacts from dust (i.e., fugitive PM10 and PM2.5) to be less than significant if BMPs are implemented (listed below). BAAQMD strongly encourages enhanced BMPs for construction sites near schools, residential areas, other sensitive land uses, or if air quality impacts were found to be significant. Table 1. BAAQMD CEQA Significance Thresholds Criteria Air Pollutant Construction Thresholds Average Daily Emissions (lbs./day) ROG 54 NOx 54 PM10 82 (Exhaust) PM2.5 54 (Exhaust) CO Not Applicable Fugitive Dust (PM10/PM2.5) Best Management Practices (BMPs)* Health Risks and Hazards Single Sources / Individual Projects Combined Sources (Cumulative from all sources within 1000-foot zone of influence) Excess Cancer Risk >10 in a million OR Compliance with Qualified Community Risk Reduction Plan >100 in a million OR Compliance with Qualified Community Risk Reduction Plan Hazard Index >1.0 >10.0 Incremental annual PM2.5 >0.3 μg/m3 >0.8 μg/m3 Note: ROG = reactive organic gases, NOx = nitrogen oxides, PM10 = course particulate matter or particulates with an aerodynamic diameter of 10 micrometers (μm) or less, PM2.5 = fine particulate matter or particulates with an aerodynamic diameter of 2.5μm or less. * BAAQMD strongly recommends implementing all feasible fugitive dust management practices especially when construction projects are located near sensitive communities, including schools, residential areas, or other sensitive land uses. 7 Bay Area Air Quality Management District, 2022 CEQA Guidelines. April 2023. Page 534 Los Gatos 2040 General Plan The Los Gatos 2040 General Plan was adopted by the Los Gatos Town Council on June 30, 2022. The following air quality policies are applicable to the project: Policy ENV-8.1 Air Quality Standards. Federal, State, and regional air quality goals, policies, standards, and requirements shall be addressed during environmental review for local land use and development decisions. Applicable standards or requirements, if not already in the proposed plans, shall be incorporated as conditions of approval. Policy ENV-8.7 Reduce Effects of High Air Pollutant Concentrations. Require developments to incorporate site planning techniques that reduce exposure of people to the impacts of high air pollutants from adjacent roadways. Policy ENV-8.9 Air Pollution Impacts During Construction. Require project proponents to prepare and implement a construction management plan that incorporates Best Available Control Measures and all best management practices in accordance with the Air District standards to reduce criteria pollutants. Construction Period Emissions The California Emissions Estimator Model (CalEEMod) Version 2022 was used to estimate emissions from on-site construction activity, construction vehicle trips, and evaporative emissions. The project land use types and size were input to CalEEMod. The CalEEMod model output along with construction inputs are included in Attachment 1. CalEEMod Inputs Land Uses The proposed project land uses were entered into CalEEMod as described in Table 2. Table 2. Summary of Project Land Use Inputs Project Land Uses Size Units Square Feet (sf) Acreage Golf Course 87.67 Acre - 87.67 Construction Inputs CalEEMod computes annual emissions for construction that are based on the project type, size, and acreage. The model provides emission estimates for both on-site and off-site construction activities. On-site activities are primarily made up of construction equipment emissions, while off- site activity includes worker, hauling, and vendor traffic. The construction build-out scenario, including equipment quantities, average hours per day, total number of workdays, and schedule, were based on information provided by the project applicant (included in Attachment 1). The Page 535 project applicant estimates the earliest possible start date to be March 2026, and the project would be built out over a period of approximately 7 months, or 161 construction workdays. Construction Traffic Emissions Construction would produce traffic in the form of worker trips and truck traffic. The traffic-related emissions are based on worker and vendor trip estimates produced by CalEEMod and haul trips that were computed based on the amount of asphalt truck trips to and from the site. CalEEMod provides daily estimates of worker and vendor trips for each applicable phase. The amount of asphalt was provided and converted to daily one-way trips, assuming two trips per delivery. There is no planned export or import of soil material as the cut and grade will be balanced. Summary of Computed Construction Period Emissions Average daily construction emissions were estimated for the total duration of the project (161 days). Table 3 shows the average daily construction emissions of ROG, NOX, PM10 exhaust, and PM2.5 exhaust during construction of the project. As indicated in Table 3, the predicted project unmitigated construction emissions would not exceed the BAAQMD significance thresholds during any year of construction. Table 3. Construction Period Emissions - Unmitigated Year ROG NOx PM10 Exhaust PM2.5 Exhaust Construction Emissions Total (Tons) 2026 0.15 1.32 0.04 0.04 Average Daily Construction Emissions (pounds/day) 2026 (161 construction workdays) 1.86 16.35 0.50 0.46 BAAQMD Thresholds (pounds per day) 54 lbs./day 54 lbs./day 82 lbs./day 54 lbs./day Exceed Threshold? No No No No Construction activities, particularly during site preparation and grading, would temporarily generate fugitive dust in the form of PM10 and PM2.5. Sources of fugitive dust would include disturbed soils at the construction site and trucks carrying uncovered loads of soils. Unless properly controlled, vehicles leaving the site would deposit mud on local streets, which could be an additional source of airborne dust after it dries. The BAAQMD recommends all projects include a “basic” set of best management practices (BMPs) to manage fugitive dust and consider impacts from dust (i.e. fugitive PM10 and PM2.5) to be less than significant BMPs are implemented. The project would be required to implement the BMPs recommended by BAAQMD during all phases of construction to reduce dust and other particulate matter emissions, per the Town’s General Plan policy ENV-8.9. General Plan Policy ENV-8.9: Include BAAQMD basic BMPs to control dust and exhaust during construction. During any construction period ground disturbance, the applicant shall ensure that the project contractor implement measures to control dust and exhaust. Implementation of the measures Page 536 recommended by BAAQMD and listed below would reduce the air quality impacts associated with grading and new construction to a less-than-significant level. 1. All exposed surfaces (e.g., parking areas, staging areas, soil piles, graded areas, and unpaved access roads) shall be watered two times per day. 2. All haul trucks transporting soil, sand, or other loose material off-site shall be covered. 3. All visible mud/dirt track-out onto adjacent public roads shall be removed using wet power vacuum street sweepers at least once per day. The use of dry power sweeping is prohibited. 4. All vehicle speeds on unpaved roads shall be limited to 15 miles per hour (mph). 5. All roadways, driveways, and sidewalks to be paved shall be completed as soon as practicable. Building pads shall be laid as soon as practicable after grading unless seeding or soil binders are used. 6. All excavation, grading, and/or demolition activities shall be suspended when average wind speeds exceed 20 mph. 7. All trucks and equipment, including their tires, shall be washed off prior to leaving the site. 8. Unpaved roads providing access to site located 100 feet of further from a paved road shall be treated with a 6- to 12-inch layer of compacted layer of wood chips, mulch, or gravel. 9. Publicly visible signs shall be posted with the telephone number and name of the person to contact at the lead agency regarding dust complaints. This person shall respond and take corrective action within 48 hours. The Air District’s General Air Pollution Complaints number shall be visible to ensure compliance with applicable regulations. The Town’s General Plan Policy ENV-8.9 is consistent with BAAQMD-recommended basic BMPs for reducing fugitive dust contained in the BAAQMD CEQA Air Quality Guidelines. For this analysis, only the basic set of BMPs are required as the Project emissions and PM2.5 impacts were below the BAAQMD thresholds. Enhanced BMPs would be required as mitigation if air quality impacts were found to be significant. Page 537 Construction Health Risk Impacts Health risk impacts were addressed by predicting increased lifetime cancer risk, the increase in annual PM2.5 concentrations, and computing the Hazard Index (HI) for non-cancer health risks. Construction activity is the only source of TAC emissions from the Project that would have health risk impacts. Construction equipment and associated heavy-duty truck traffic generates diesel exhaust, which is a known TAC. These exhaust emissions pose health risks for sensitive receptors such as surrounding residents. The primary health risk impact issues associated with construction emissions are cancer risk and exposure to PM2.5. A health risk assessment of the project construction activities was conducted that evaluated potential health effects to nearby sensitive receptors from construction emissions of DPM and PM2.5.8 This assessment included dispersion modeling to predict the off-site concentrations resulting from project construction, so that lifetime cancer risks and non-cancer health effects could be evaluated. Modeled Sensitive Receptors Receptors for this assessment included locations where sensitive populations would be present for extended periods of time (i.e., chronic exposures). This includes the existing residences surrounding the site and Roxbury Elderly Care as shown in Figure 1. Residential receptors are assumed to include all receptor groups (i.e., third trimester, infants, children, and adults) with almost continuous exposure to project emissions. Roxbury Elderly Care is assumed to be adults only with almost continuous exposure to project emissions. While there are additional receptors within 1,000 feet of the project site, the receptors chosen are adequate to identify maximum impacts from the project. Construction Emissions The CalEEMod model provided total uncontrolled annual PM10 exhaust emissions (assumed to be DPM) for the off-road construction equipment and for exhaust emissions from on-road vehicles. Total DPM emissions were estimated to be 0.04 tons (81 pounds). Fugitive dust emissions (PM2.5), which reflect the application of BMPs, are less than 0.01 tons (1 pound) from all construction stages. The on-road emissions are a result of haul truck travel during grading activities, worker travel, and vendor deliveries during construction. A trip length of one mile was used to represent vehicle travel while at or near the construction site. It was assumed that the emissions from on- road vehicles traveling at or near the site would occur at the construction site. Dispersion Modeling The U.S. EPA AERMOD dispersion model was used to predict DPM and PM2.5 concentrations at sensitive receptors (i.e., residences) in the vicinity of the project construction area. The AERMOD dispersion model is a BAAQMD-recommended model for use in modeling analysis of these types of emission activities for CEQA projects.9 Emission sources for the construction site were grouped into two categories: exhaust emissions of DPM and fugitive PM2.5 dust emissions. 8 DPM is identified by California as a toxic air contaminant due to the potential to cause cancer. 9 BAAQMD, 2023, Appendix E of the 2022 BAAQMD CEQA Guidelines. April. Page 538 Construction Sources To represent the construction equipment exhaust emissions, an area source was used with an emission release height of 20 feet (6 meters).10 The release height incorporates both the physical release height from the construction equipment (i.e., the height of the exhaust pipe) and plume rise after it leaves the exhaust pipe. Plume rise is due to both the high temperature of the exhaust and the high velocity of the exhaust gas. It should be noted that when modeling an area source, plume rise is not calculated by the AERMOD dispersion model as it would do for a point source (exhaust stack). Therefore, the release height from an area source used to represent emissions from sources with plume rise, such as construction equipment, was based on the height the exhaust plume is expected to achieve, not just the height of the top of the exhaust pipe. For modeling fugitive PM2.5 emissions, an area source with a near-ground level release height of 7 feet (2 meters) was used. Fugitive dust emissions at construction sites come from a variety of sources, including truck and equipment travel, grading activities, truck loading (with loaders) and unloading (rear or bottom dumping), loaders and excavators moving and transferring soil and other materials, etc. All of these activities result in fugitive dust emissions at various heights at the point(s) of generation. Once generated, the dust plume will tend to rise as it moves downwind across the site and exit the site at a higher elevation than when it was generated. For all these reasons, a 7-foot release height was used as the average release height across the construction site. Emissions from the construction equipment and on-road vehicle travel were distributed throughout the modeled area sources. AERMOD Inputs and Meteorological Data The modeling used a five-year meteorological data set (2013-2017) from the San José Airport prepared for use with the AERMOD model by the BAAQMD. Construction emissions were modeled as occurring Monday through Friday between 7:00 a.m. to 5:30 p.m. and on Saturdays between 9:00 a.m. to 5:30 p.m., when the majority of construction is expected to occur according to the project applicant. Annual DPM and PM2.5 concentrations from construction activities during the 2026 period were calculated at nearby sensitive receptors using the model. Receptor heights of 5 feet (1.5 meters) were used to represent the breathing height on the first floor of nearby residences and at Roxbury Elderly Care.11 Summary of Construction Health Risk Impacts The maximum increased cancer risks were calculated using the modeled TAC concentrations combined with BAAQMD CEQA guidance for age sensitivity factors and exposure parameters. Age-sensitivity factors reflect the greater sensitivity of infants and small children to cancer causing TACs. Third trimester, infant, child, and adult exposures were assumed to occur at all residences 10 California Air Resource Board, 2007. Proposed Regulation for In-Use Off-Road Diesel Vehicles, Appendix D: Health Risk Methodology. April. Web: https://ww3.arb.ca.gov/regact/2007/ordiesl07/ordiesl07.htm 11 Bay Area Air Quality Management District, 2012, Recommended Methods for Screening and Modeling Local Risks and Hazards, Version 3.0. May. Web: https://www.baaqmd.gov/~/media/files/planning-and- research/ceqa/risk-modeling-approach-may-2012.pdf?la=en Page 539 during the entire construction period, while adult exposures were assumed at Roxbury Elderly Care. Non-cancer health hazards and maximum PM2.5 concentrations were also calculated. The maximum modeled annual PM2.5 concentration was calculated based on combined exhaust and fugitive concentrations. The maximum computed HI value was based on the ratio of the maximum DPM concentration modeled and the chronic inhalation DPM reference exposure level of 5 μg/m3. The modeled maximum annual DPM and PM2.5 concentrations were identified at nearby sensitive receptors to find the MEI. Results of this assessment indicated that the construction MEI was located on the first floor (5 feet above the ground) of a single-family residence east of the project site. The location of the MEI and nearby sensitive receptors are shown in Figure 1. Table 4 summarizes the maximum cancer risks, PM2.5 concentrations, and health hazard indexes for project related construction activities. Attachment 2 to this report includes the emission calculations used for construction modeling and the cancer risk calculations. As shown in Table 4, the project’s uncontrolled construction maximum cancer risk, annual PM2.5 concentration, and HI do not exceed their respective BAAQMD single-source significance threshold. Additionally, modeling was conducted to predict the cancer risks, non-cancer health hazards, and maximum PM2.5 concentrations associated with construction activities at the nearby Roxbury Elderly Care. The maximum increased cancer risks were adjusted using adult exposure parameters. The cancer risk, PM2.5 concentration, and HI did not exceed their respective BAAQMD single- source significance thresholds, as shown in Table 4. Table 4. Construction Risk Impacts at the Off-Site MEIs Source Cancer Risk1 (per million) Annual PM2.51 (μg/m3) Hazard Index Project Construction Unmitigated 2.10 (infant) 0.01 <0.01 BAAQMD Single-Source Threshold >10.0 >0.3 >1.0 Exceed Threshold? Unmitigated No No No Impacts at Roxbury Elderly Care Project Construction Unmitigated <0.01 (adult) <0.01 <0.01 BAAQMD Single-Source Threshold >10.0 >0.3 >1.0 Exceed Threshold? Unmitigated No No No Page 540 Figure 1. Location of Project Construction Site, Off-Site Sensitive Receptors, and Maximum TAC Impact (MEI) Cumulative Health Risk Impacts Cumulative health risk assessments look at all substantial sources of TACs located within 1,000 feet of a project site (i.e., influence area) that can affect sensitive receptors. These sources include rail lines, highways, busy surface streets, and stationary sources identified by BAAQMD. A review of the project area using BAAQMD’s geographic information systems (GIS) screening maps identified the existing health risks from nearby roadway and stationary sources at the MEI. Local roadways and five stationary sources within the 1,000-foot influence area could have cumulative health risk impacts at the MEI. Figure 2 shows the locations of the sources affecting the MEIs within the influence area. Health risk impacts from these sources upon the MEI are reported in Table 5. Details of the cumulative screening and health risk calculations are included in Attachment 3. Page 541 Figure 2. Project Site and Nearby TAC and PM2.5 Sources Nearby Local Roadways The project site is located near multiple intersecting streets. Cancer risk, PM2.5 concentrations, and HI associated with traffic on the nearby roadways were estimated using BAAQMD screening values provided via GIS data files (i.e., raster files).12 BAAQMD raster files provide screening- level cancer risk, PM2.5 concentrations, and HI for roadways within the Bay Area and were produced using AERMOD and 20x20-meter emissions grid. The raster file uses EMFAC2021 data for vehicle emissions and fleet mix for roadways and includes Appendix E of the Air District’s CEQA Air Quality Guidance for risk assessment assumptions. These estimates represent conservative risks reflective of 2022 conditions and are meant to provide a conservative estimate of future conditions, which do not reflect the increased proportion of zero emission motor vehicles that will result in lower future emissions.13 These screening values are considered higher than values that would be obtained with refined modeling methods. These raster data are based on region-wide emissions rather than just those that occur within 1,000 feet of the project. More information regarding the assumptions used to develop the screening layers can be found in Sections 6 and 7 in Appendix E of BAAQMD’s 2022 CEQA guidance.14 Screening-level cancer 12 BAAQMD, Health Risk Screening and Modeling, 2022. Web: https://www.baaqmd.gov/plans-and- climate/california-environmental-quality-act-ceqa/ceqa-tools/health-risk-screening-and-modeling 13 BAAQMD, 2022. BAAQMD CEQA Air Quality Guidelines Appendix E, Section 9. April 2023 14 BAAQMD, 2022. BAAQMD CEQA Air Quality Guidelines Appendix E, Sections 6 and 7, April 2023. Page 542 risk, PM2.5 concentration, and HI for the cumulative roadway impacts at the construction MEI are listed in Table 5. BAAQMD Permitted Stationary Sources Permitted stationary sources of air pollution near the project site were identified using BAAQMD’s Permitted Stationary Sources 2022 GIS website,15 which identifies the location of nearby stationary sources and their estimated risk and hazard impacts, including emissions and adjustments to account for OEHHA guidance. Five sources were identified using this tool, two gas dispensing facilities (GDF), and three emergency diesel generators. While these sources are within 1,000 feet from the edge of the project site, the closest source to the MEI is approximately 1,500 feet away with others over 3,000 feet away. Risks from these existing stationary sources would be negligible as the distance between source and MEI is too great for any meaningful TAC concentration to affect the MEI. Building downwash, wind interaction with terrain, and other environmental factors would assist in diluting any airborne TAC concentration. As a result, risks from existing stationary sources upon the MEI are considered negligible and are not included in this analysis. Summary of Cumulative Health Risk Impact at Construction MEIs Table 5 reports both the project and cumulative health risk impacts at the sensitive receptor most affected by construction (i.e., the MEI). As shown in Table 5, the project does not exceed any BAAQMD single-source or cumulative source threshold. Table 5. Impacts from Combined Sources at Project MEI Source Cancer Risk (per million) Annual PM2.5 (μg/m3) Hazard Index Project Impacts Project Construction Unmitigated 2.10 (infant) 0.01 <0.01 BAAQMD Single-Source Threshold >10.0 >0.3 >1.0 Exceed Threshold? Unmitigated No No No Cumulative Impacts Cumulative Roadways – BAAQMD Screening GIS Data 3.13 0.12 0.01 Cumulative Total Unmitigated 5.23 0.13 <0.02 BAAQMD Cumulative Source Threshold 100 0.8 10.0 Exceed Threshold? Unmitigated No No No 15 BAAQMD, https://baaqmd.maps.arcgis.com/apps/webappviewer/index.html?id=845658c19eae4594b9f4b805fb9d89a3 Page 543 Supporting Documentation Attachment 1 includes the CalEEMod outputs for project construction emissions. Also included are any modeling assumptions. Attachment 2 includes the health risk assessment. This includes the summary of the dispersion modeling and the cancer risk calculations for construction. The AERMOD dispersion modeling files for this assessment, which are quite voluminous, are available upon request and would be provided in digital format. Attachment 3 includes the cumulative health risk screening and calculations from sources affecting the construction MEI. Page 544 Attachment 1: CalEEMod Input Assumptions and Outputs Page 545 Air Quality/Noise Construction Information Data Request Project Name: LaRinconada CC See Equipment Type TAB for type, horsepower and load factor Project Size Dwelling Units 87.67 total project acres disturbed s.f. residential Pile Driving? No s.f. retail s.f. office/commercial Project include on-site GENERATOR OR FIRE PUMP during project OPERATION (not construction)? Y/N? No s.f. other, specify:IF YES (if BOTH separate values) --> s.f. parking garage spaces Kilowatts/Horsepower: __________ s.f. parking lot spaces Fuel Type: _____________ Construction Days (i.e, M-F) Monday to Saturday Location in project (Plans Desired if Available): Construction Hours (weekdays) 7:00 am to 5:30 pm Consturction Hours (Weekend) 9 am to 5:30 pm DO NOT MULTIPLY EQUIPMENT HOURS/DAY BY THE QUANTITY OF EQUIPMENT Quantity Description HP Load Factor Hours/day Total Work Days Avg. Hours per day HP Annual Hours Comments Demolition Start Date: Total phase:Overall Import/Export Volumes End Date: Concrete/Industrial Saws 33 0.73 #DIV/0!0 Demolition Volume Excavators 36 0.38 #DIV/0!0 Square footage of buildings to be demolishedRubber-Tired Dozers 367 0.4 #DIV/0!0 (or total tons to be hauled) Tractors/Loaders/Backhoes 84 0.37 #DIV/0!0 _0_ square feet or Other Equipment?_0_ Hauling volume (tons)Any pavement demolished and hauled? _0_ tons Site Preparation Start Date:3/23/2026 Total phase:120 End Date:8/8/2026 0 Graders 148 0.41 0 0 0 0 0 Rubber Tired Dozers 367 0.4 0 0 0 0 3 Tractors/Loaders/Backhoes 84 0.37 10 120 10 111888Other Equipment? Grading / Excavation Start Date: 3/30/2026 Total phase: 150 THIS PHASE WOULD OVERLAP WITH THE SITE PREPARATION End Date: 9/19/2026 Soil Hauling Volume 10 Excavators 36 0.38 10 150 10 205200 Export volume = 0 cubic yards? 0 Graders 148 0.41 0 0 0 0 Import volume = 0 cubic yards? 0 Rubber Tired Dozers 367 0.4 0 0 0 00Concrete/Industrial Saws 33 0.73 0 0 0 0 3 Tractors/Loaders/Backhoes 84 0.37 10 150 10 139860 Other Equipment? Trenching/Foundation Start Date: Total phase: End Date: Tractor/Loader/Backhoe 84 0.37 #DIV/0!0 Excavators 36 0.38 #DIV/0!0Other Equipment? Building - Exterior Start Date:Total phase:Cement Trucks? _?_ Total Round-Trips End Date: Cranes 367 0.29 #DIV/0!0 Electric? (Y/N) ___ Otherwise assumed diesel Forklifts 82 0.2 #DIV/0!0 Liquid Propane (LPG)? (Y/N) ___ Otherwise Assumed diesel Generator Sets 14 0.74 #DIV/0!0 Or temporary line power? (Y/N) ___Tractors/Loaders/Backhoes 84 0.37 #DIV/0!0Welders460.45 #DIV/0!0 Other Equipment? Building - Interior/Architectural Coating Start Date:Total phase: End Date: Air Compressors 37 0.48 #DIV/0!0Aerial Lift 46 0.31 #DIV/0!0 Other Equipment? Paving Start Date: 9/20/2026 Total phase: 5 Start Date: 9/25/2026 0 Cement and Mortar Mixers 10 0.56 0 0 0 0 1 Pavers 81 0.42 10 5 10 1701 1 Paving Equipment 89 0.36 10 5 10 16021Rollers360.38 10 5 10 6841Tractors/Loaders/Backhoes 84 0.37 10 5 10 1554 Other Equipment? Additional Phases Start Date: Total phase: Start Date: #DIV/0!0#DIV/0!0#DIV/0!0#DIV/0!0#DIV/0!0 Equipment types listed in "Equipment Types" worksheet tab. Equipment listed in this sheet is to provide an example of inputs Complete one sheet for each project component It is assumed that water trucks would be used during gradingAdd or subtract phases and equipment, as appropriate Modify horsepower or load factor, as appropriate Complete ALL Portions in Yellow Asphalt? 8000 Square Feet Page 546 UnmitigatedROGNOXPM10 ExhaustPM2.5 Exhaust PM2.5 FugitiveCO2e YearMT20260.151.320.040.040.01279.37Tons0.151.320.040.04279.37Pounds/Workdays20261.8616.350.500.46161Threshold - lbs/day54.054.082.054.0Pounds299.072631.8581.0674.580.00Average1.8616.350.500.460.00161.00Threshold - lbs/day54.054.082.054.0Construction EquipmentConstruction Criteria Air PollutantsAverage Daily Emissions WorkdaysTotal Construction Emissions TonsTotal Construction Emissions Page 547 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20251 / 5425-007 La Rinconada Country Club, Los Gatos BMPs T4F DetailedReportTable of Contents1. Basic Project Information1.1. Basic Project Information1.2. Land Use Types1.3. User-Selected Emission Reduction Measures by Emissions Sector2. Emissions Summary2.1. Construction Emissions Compared Against Thresholds2.2. Construction Emissions by Year, Unmitigated2.3. Construction Emissions by Year, Mitigated2.4. Operations Emissions Compared Against Thresholds2.5. Operations Emissions by Sector, Unmitigated2.6. Operations Emissions by Sector, Mitigated3. Construction Emissions Details3.1. Site Preparation (2026) - Unmitigated3.2. Site Preparation (2026) - MitigatedPage 548 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20252 / 543.3. Grading (2026) - Unmitigated3.4. Grading (2026) - Mitigated3.5. Paving (2026) - Unmitigated3.6. Paving (2026) - Mitigated4. Operations Emissions Details4.1. Mobile Emissions by Land Use4.1.1. Unmitigated4.1.2. Mitigated4.2. Energy4.2.1. Electricity Emissions By Land Use - Unmitigated4.2.2. Electricity Emissions By Land Use - Mitigated4.2.3. Natural Gas Emissions By Land Use - Unmitigated4.2.4. Natural Gas Emissions By Land Use - Mitigated4.3. Area Emissions by Source4.3.1. Unmitigated4.3.2. Mitigated4.4. Water Emissions by Land Use4.4.1. UnmitigatedPage 549 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20253 / 544.4.2. Mitigated4.5. Waste Emissions by Land Use4.5.1. Unmitigated4.5.2. Mitigated4.6. Refrigerant Emissions by Land Use4.6.1. Unmitigated4.6.2. Mitigated4.7. Offroad Emissions By Equipment Type4.7.1. Unmitigated4.7.2. Mitigated4.8. Stationary Emissions By Equipment Type4.8.1. Unmitigated4.8.2. Mitigated4.9. User Defined Emissions By Equipment Type4.9.1. Unmitigated4.9.2. Mitigated4.10. Soil Carbon Accumulation By Vegetation Type4.10.1. Soil Carbon Accumulation By Vegetation Type - UnmitigatedPage 550 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20254 / 544.10.2. Above and Belowground Carbon Accumulation by Land Use Type - Unmitigated4.10.3. Avoided and Sequestered Emissions by Species - Unmitigated4.10.4. Soil Carbon Accumulation By Vegetation Type - Mitigated4.10.5. Above and Belowground Carbon Accumulation by Land Use Type - Mitigated4.10.6. Avoided and Sequestered Emissions by Species - Mitigated5. Activity Data5.1. Construction Schedule5.2. Off-Road Equipment5.2.1. Unmitigated5.2.2. Mitigated5.3. Construction Vehicles5.3.1. Unmitigated5.3.2. Mitigated5.4. Vehicles5.4.1. Construction Vehicle Control Strategies5.5. Architectural Coatings5.6. Dust Mitigation5.6.1. Construction Earthmoving ActivitiesPage 551 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20255 / 545.6.2. Construction Earthmoving Control Strategies5.7. Construction Paving5.8. Construction Electricity Consumption and Emissions Factors5.9. Operational Mobile Sources5.9.1. Unmitigated5.9.2. Mitigated5.10. Operational Area Sources5.10.1. Hearths5.10.1.1. Unmitigated5.10.1.2. Mitigated5.10.2. Architectural Coatings5.10.3. Landscape Equipment5.10.4. Landscape Equipment - Mitigated5.11. Operational Energy Consumption5.11.1. Unmitigated5.11.2. Mitigated5.12. Operational Water and Wastewater Consumption5.12.1. UnmitigatedPage 552 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20256 / 545.12.2. Mitigated5.13. Operational Waste Generation5.13.1. Unmitigated5.13.2. Mitigated5.14. Operational Refrigeration and Air Conditioning Equipment5.14.1. Unmitigated5.14.2. Mitigated5.15. Operational Off-Road Equipment5.15.1. Unmitigated5.15.2. Mitigated5.16. Stationary Sources5.16.1. Emergency Generators and Fire Pumps5.16.2. Process Boilers5.17. User Defined5.18. Vegetation5.18.1. Land Use Change5.18.1.1. Unmitigated5.18.1.2. MitigatedPage 553 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20257 / 545.18.1. Biomass Cover Type5.18.1.1. Unmitigated5.18.1.2. Mitigated5.18.2. Sequestration5.18.2.1. Unmitigated5.18.2.2. Mitigated6. Climate Risk Detailed Report6.1. Climate Risk Summary6.2. Initial Climate Risk Scores6.3. Adjusted Climate Risk Scores6.4. Climate Risk Reduction Measures7. Health and Equity Details7.1. CalEnviroScreen 4.0 Scores7.2. Healthy Places Index Scores7.3. Overall Health & Equity Scores7.4. Health & Equity Measures7.5. Evaluation Scorecard7.6. Health & Equity Custom MeasuresPage 554 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20258 / 548. User Changes to Default DataPage 555 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/20259 / 541. Basic Project Information1.1. Basic Project InformationData FieldValueProject Name25-007 La Rinconada Country Club, Los Gatos BMPs T4FConstruction Start Date3/23/2026Operational Year2027Lead Agency—Land Use ScaleProject/siteAnalysis Level for Defaults CountyWindspeed (m/s)3.00Precipitation (days)12.8Location14595 Clearview Dr, Los Gatos, CA 95032, USACountySanta ClaraCityLos GatosAir DistrictBay Area AQMDAir BasinSan Francisco Bay AreaTAZ1785EDFZ1Electric UtilitySilicon Valley Clean EnergyGas UtilityPacific Gas & ElectricApp Version2022.1.1.291.2. Land Use TypesLand Use SubtypeSizeUnitLot AcreageBuilding Area (sq ft)Landscape Area (sqft)Special LandscapeArea (sq ft)PopulationDescriptionGolf Course 87.7 Acre 87.7 0.00 0.00 0.00 — —Page 556 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202510 / 541.3. User-Selected Emission Reduction Measures by Emissions SectorSector#Measure TitleConstruction C-5 Use Advanced Engine Tiers2. Emissions Summary2.1. Construction Emissions Compared Against ThresholdsCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Un/Mit.ROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Unmit. 2.07 18.1 0.56 0.33 0.89 0.51 0.08 0.59 4,303Mit. 0.60 9.45 0.07 0.33 0.40 0.07 0.08 0.15 4,303% Reduced 71% 48% 87% — 55% 86% — 75% —Daily, Winter(Max)—————————Unmit. 2.05 18.1 0.56 0.33 0.89 0.51 0.08 0.59 4,278Mit. 0.59 9.47 0.07 0.33 0.40 0.07 0.08 0.15 4,278% Reduced 71% 48% 87% — 55% 86% — 75% —Average Daily(Max)—————————Unmit. 0.82 7.21 0.22 0.13 0.35 0.20 0.03 0.24 1,687Mit. 0.23 3.87 0.03 0.13 0.16 0.03 0.03 0.06 1,687% Reduced 72% 46% 87% — 55% 86% — 75% —Annual(Max)—————————Unmit. 0.15 1.32 0.04 0.02 0.06 0.04 0.01 0.04 279Mit. 0.04 0.71 0.01 0.02 0.03 0.01 0.01 0.01 279% Reduced 72% 46% 87% — 55% 86% — 75% —Page 557 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202511 / 542.2. Construction Emissions by Year, UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)YearROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily - Summer(Max)—————————2026 2.07 18.1 0.56 0.33 0.89 0.51 0.08 0.59 4,303Daily - Winter(Max)—————————2026 2.05 18.1 0.56 0.33 0.89 0.51 0.08 0.59 4,278Average Daily—————————2026 0.82 7.21 0.22 0.13 0.35 0.20 0.03 0.24 1,687Annual—————————2026 0.15 1.32 0.04 0.02 0.06 0.04 0.01 0.04 2792.3. Construction Emissions by Year, MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)YearROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily - Summer(Max)—————————2026 0.60 9.45 0.07 0.33 0.40 0.07 0.08 0.15 4,303Daily - Winter(Max)—————————2026 0.59 9.47 0.07 0.33 0.40 0.07 0.08 0.15 4,278Average Daily—————————2026 0.23 3.87 0.03 0.13 0.16 0.03 0.03 0.06 1,687Annual—————————2026 0.04 0.71 0.01 0.02 0.03 0.01 0.01 0.01 279Page 558 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202512 / 542.4. Operations Emissions Compared Against ThresholdsCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Un/Mit.ROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Unmit. 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,306Daily, Winter(Max)—————————Unmit. 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,175Average Daily(Max)—————————Unmit. 0.96 0.80 0.01 1.98 1.99 0.01 0.50 0.51 2,194Annual(Max)—————————Unmit. 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 3632.5. Operations Emissions by Sector, UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)SectorROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Mobile 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,152Area 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————154Refrig.————————0.00Total 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,306Daily, Winter(Max)—————————Page 559 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202513 / 54Mobile 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,021Area0.00————————Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————154Refrig.————————0.00Total 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,175Average Daily—————————Mobile 0.96 0.80 0.01 1.98 1.99 0.01 0.50 0.51 2,040Area 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————154Refrig.————————0.00Total 0.96 0.80 0.01 1.98 1.99 0.01 0.50 0.51 2,194Annual—————————Mobile 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 338Area 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————25.5Refrig.————————0.00Total 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 3632.6. Operations Emissions by Sector, MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)SectorROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2ePage 560 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202514 / 54—————————Daily, Summer(Max)Mobile 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,152Area 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————154Refrig.————————0.00Total 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,306Daily, Winter(Max)—————————Mobile 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,021Area0.00————————Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————154Refrig.————————0.00Total 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,175Average Daily—————————Mobile 0.96 0.80 0.01 1.98 1.99 0.01 0.50 0.51 2,040Area 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————154Refrig.————————0.00Total 0.96 0.80 0.01 1.98 1.99 0.01 0.50 0.51 2,194Annual—————————Mobile 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 338Area 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Page 561 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202515 / 54Energy 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Water————————0.00Waste————————25.5Refrig.————————0.00Total 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 3633. Construction Emissions Details3.1. Site Preparation (2026) - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)LocationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eOnsite—————————Daily, Summer(Max)—————————Off-RoadEquipment0.38 3.87 0.13 — 0.13 0.12 — 0.12 1,093Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Off-RoadEquipment0.38 3.87 0.13 — 0.13 0.12 — 0.12 1,093Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Off-RoadEquipment0.12 1.27 0.04 — 0.04 0.04 — 0.04 359Page 562 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202516 / 54Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Off-RoadEquipment0.02 0.23 0.01 — 0.01 0.01 — 0.01 59.5Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Offsite—————————Daily, Summer(Max)—————————Worker 0.02 0.02 0.00 0.06 0.06 0.00 0.01 0.01 64.0Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Worker 0.02 0.02 0.00 0.06 0.06 0.00 0.01 0.01 59.2Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Worker 0.01 0.01 0.00 0.02 0.02 0.00 < 0.005 < 0.005 19.7Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Worker < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.00 < 0.005 < 0.005 3.26Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Page 563 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202517 / 543.2. Site Preparation (2026) - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)LocationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eOnsite—————————Daily, Summer(Max)—————————Off-RoadEquipment0.10 0.53 0.02 — 0.02 0.02 — 0.02 1,093Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Off-RoadEquipment0.10 0.53 0.02 — 0.02 0.02 — 0.02 1,093Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Off-RoadEquipment0.03 0.18 0.01 — 0.01 0.01 — 0.01 359Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Off-RoadEquipment0.01 0.03 < 0.005 — < 0.005 < 0.005 — < 0.005 59.5Dust FromMaterialMovement———0.000.00—0.000.00—Page 564 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202518 / 54Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Offsite—————————Daily, Summer(Max)—————————Worker 0.02 0.02 0.00 0.06 0.06 0.00 0.01 0.01 64.0Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Worker 0.02 0.02 0.00 0.06 0.06 0.00 0.01 0.01 59.2Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Worker 0.01 0.01 0.00 0.02 0.02 0.00 < 0.005 < 0.005 19.7Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Worker < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.00 < 0.005 < 0.005 3.26Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.003.3. Grading (2026) - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)LocationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eOnsite—————————Daily, Summer(Max)—————————Off-RoadEquipment1.56 14.1 0.43 — 0.43 0.39 — 0.39 2,869Page 565 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202519 / 54Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Off-RoadEquipment1.56 14.1 0.43 — 0.43 0.39 — 0.39 2,869Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Off-RoadEquipment0.64 5.81 0.18 — 0.18 0.16 — 0.16 1,179Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Off-RoadEquipment0.12 1.06 0.03 — 0.03 0.03 — 0.03 195Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Offsite—————————Daily, Summer(Max)—————————Worker 0.10 0.07 0.00 0.27 0.27 0.00 0.06 0.06 278Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Page 566 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202520 / 54Worker 0.09 0.09 0.00 0.27 0.27 0.00 0.06 0.06 257Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Worker 0.04 0.03 0.00 0.11 0.11 0.00 0.03 0.03 107Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Worker 0.01 0.01 0.00 0.02 0.02 0.00 < 0.005 < 0.005 17.7Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.003.4. Grading (2026) - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)LocationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eOnsite—————————Daily, Summer(Max)—————————Off-RoadEquipment0.37 8.83 0.05 — 0.05 0.05 — 0.05 2,869Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Off-RoadEquipment0.37 8.83 0.05 — 0.05 0.05 — 0.05 2,869Dust FromMaterialMovement———0.000.00—0.000.00—Page 567 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202521 / 54Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Off-RoadEquipment0.15 3.63 0.02 — 0.02 0.02 — 0.02 1,179Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Off-RoadEquipment0.03 0.66 < 0.005 — < 0.005 < 0.005 — < 0.005 195Dust FromMaterialMovement———0.000.00—0.000.00—Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Offsite—————————Daily, Summer(Max)—————————Worker 0.10 0.07 0.00 0.27 0.27 0.00 0.06 0.06 278Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Worker 0.09 0.09 0.00 0.27 0.27 0.00 0.06 0.06 257Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Average Daily—————————Worker 0.04 0.03 0.00 0.11 0.11 0.00 0.03 0.03 107Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Page 568 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202522 / 54Worker 0.01 0.01 0.00 0.02 0.02 0.00 < 0.005 < 0.005 17.7Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.003.5. Paving (2026) - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)LocationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eOnsite—————————Daily, Summer(Max)—————————Off-RoadEquipment0.60 5.74 0.24 — 0.24 0.22 — 0.22 1,312Paving0.00————————Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Average Daily—————————Off-RoadEquipment0.01 0.08 < 0.005 — < 0.005 < 0.005 — < 0.005 18.0Paving0.00————————Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Annual—————————Off-RoadEquipment< 0.005 0.01 < 0.005 — < 0.005 < 0.005 — < 0.005 2.97Paving0.00————————Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Offsite—————————Daily, Summer(Max)—————————Worker 0.03 0.02 0.00 0.08 0.08 0.00 0.02 0.02 85.4Page 569 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202523 / 54Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.01 0.31 < 0.005 0.07 0.07 < 0.005 0.02 0.02 266Daily, Winter(Max)—————————Average Daily—————————Worker < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.00 < 0.005 < 0.005 1.09Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 3.64Annual—————————Worker < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.18Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 0.603.6. Paving (2026) - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)LocationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eOnsite—————————Daily, Summer(Max)—————————Off-RoadEquipment0.13 1.39 0.02 — 0.02 0.02 — 0.02 1,312Paving0.00————————Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Daily, Winter(Max)—————————Average Daily—————————Off-RoadEquipment< 0.005 0.02 < 0.005 — < 0.005 < 0.005 — < 0.005 18.0Paving0.00————————Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Page 570 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202524 / 54Annual—————————Off-RoadEquipment< 0.005 < 0.005 < 0.005 — < 0.005 < 0.005 — < 0.005 2.97Paving0.00————————Onsite truck 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Offsite—————————Daily, Summer(Max)—————————Worker 0.03 0.02 0.00 0.08 0.08 0.00 0.02 0.02 85.4Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling 0.01 0.31 < 0.005 0.07 0.07 < 0.005 0.02 0.02 266Daily, Winter(Max)—————————Average Daily—————————Worker < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.00 < 0.005 < 0.005 1.09Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 3.64Annual—————————Worker < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.00 < 0.005 < 0.005 0.18Vendor 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00 0.00Hauling < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 < 0.005 0.604. Operations Emissions Details4.1. Mobile Emissions by Land Use4.1.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2ePage 571 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202525 / 54Daily, Summer(Max)—————————Golf Course 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,152Total 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,152Daily, Winter(Max)—————————Golf Course 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,021Total 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,021Annual—————————Golf Course 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 338Total 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 3384.1.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Golf Course 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,152Total 1.01 0.72 0.01 2.00 2.01 0.01 0.51 0.52 2,152Daily, Winter(Max)—————————Golf Course 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,021Total 0.97 0.85 0.01 2.00 2.01 0.01 0.51 0.52 2,021Annual—————————Golf Course 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 338Total 0.17 0.15 < 0.005 0.36 0.36 < 0.005 0.09 0.09 3384.2. EnergyPage 572 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202526 / 544.2.1. Electricity Emissions By Land Use - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————0.00Total————————0.00Daily, Winter(Max)—————————GolfCourse————————0.00Total————————0.00Annual—————————GolfCourse————————0.00Total————————0.004.2.2. Electricity Emissions By Land Use - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————0.00Total————————0.00Daily, Winter(Max)—————————GolfCourse————————0.00Total————————0.00Annual—————————GolfCourse————————0.00Total————————0.00Page 573 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202527 / 544.2.3. Natural Gas Emissions By Land Use - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Golf Course 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Daily, Winter(Max)—————————Golf Course 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Annual—————————Golf Course 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.004.2.4. Natural Gas Emissions By Land Use - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Golf Course 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Daily, Winter(Max)—————————Golf Course 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Annual—————————Golf Course 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Page 574 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202528 / 544.3. Area Emissions by Source4.3.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)SourceROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————ConsumerProducts0.00————————ArchitecturalCoatings0.00————————LandscapeEquipment0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Daily, Winter(Max)—————————ConsumerProducts0.00————————ArchitecturalCoatings0.00————————Total0.00————————Annual—————————ConsumerProducts0.00————————ArchitecturalCoatings0.00————————LandscapeEquipment0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.004.3.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Page 575 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202529 / 54Source ROG NOx PM10E PM10D PM10T PM2.5E PM2.5D PM2.5T CO2eDaily, Summer(Max)—————————ConsumerProducts0.00————————ArchitecturalCoatings0.00————————LandscapeEquipment0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Daily, Winter(Max)—————————ConsumerProducts0.00————————ArchitecturalCoatings0.00————————Total0.00————————Annual—————————ConsumerProducts0.00————————ArchitecturalCoatings0.00————————LandscapeEquipment0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.00Total 0.00 0.00 0.00 — 0.00 0.00 — 0.00 0.004.4. Water Emissions by Land Use4.4.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2ePage 576 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202530 / 54—————————Daily, Summer(Max)GolfCourse————————0.00Total————————0.00Daily, Winter(Max)—————————GolfCourse————————0.00Total————————0.00Annual—————————GolfCourse————————0.00Total————————0.004.4.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————0.00Total————————0.00Daily, Winter(Max)—————————GolfCourse————————0.00Total————————0.00Annual—————————GolfCourse————————0.00Total————————0.004.5. Waste Emissions by Land UsePage 577 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202531 / 544.5.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————154Total————————154Daily, Winter(Max)—————————GolfCourse————————154Total————————154Annual—————————GolfCourse————————25.5Total————————25.54.5.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————154Total————————154Daily, Winter(Max)—————————GolfCourse————————154Total————————154Annual—————————GolfCourse————————25.5Total————————25.5Page 578 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202532 / 544.6. Refrigerant Emissions by Land Use4.6.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————0.00Total————————0.00Daily, Winter(Max)—————————GolfCourse————————0.00Total————————0.00Annual—————————GolfCourse————————0.00Total————————0.004.6.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————GolfCourse————————0.00Total————————0.00Daily, Winter(Max)—————————GolfCourse————————0.00Total————————0.00Annual—————————Page 579 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202533 / 54GolfCourse————————0.00Total————————0.004.7. Offroad Emissions By Equipment Type4.7.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Equipment TypeROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.7.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Equipment TypeROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————Page 580 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202534 / 544.8. Stationary Emissions By Equipment Type4.8.1. UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Equipment TypeROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.8.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Equipment TypeROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.9. User Defined Emissions By Equipment Type4.9.1. UnmitigatedPage 581 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202535 / 54Criteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Equipment TypeROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.9.2. MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Equipment TypeROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.10. Soil Carbon Accumulation By Vegetation Type4.10.1. Soil Carbon Accumulation By Vegetation Type - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)VegetationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Page 582 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202536 / 54Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.10.2. Above and Belowground Carbon Accumulation by Land Use Type - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.10.3. Avoided and Sequestered Emissions by Species - UnmitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)SpeciesROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Avoided—————————Subtotal—————————Sequestered—————————Subtotal—————————Removed—————————Page 583 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202537 / 54Subtotal———————————————————Daily, Winter(Max)—————————Avoided—————————Subtotal—————————Sequestered—————————Subtotal—————————Removed—————————Subtotal———————————————————Annual—————————Avoided—————————Subtotal—————————Sequestered—————————Subtotal—————————Removed—————————Subtotal———————————————————4.10.4. Soil Carbon Accumulation By Vegetation Type - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)VegetationROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Page 584 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202538 / 54Annual—————————Total—————————4.10.5. Above and Belowground Carbon Accumulation by Land Use Type - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)Land UseROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Total—————————Daily, Winter(Max)—————————Total—————————Annual—————————Total—————————4.10.6. Avoided and Sequestered Emissions by Species - MitigatedCriteria Pollutants (lb/day for daily, ton/yr for annual) and GHGs (lb/day for daily, MT/yr for annual)SpeciesROGNOxPM10EPM10DPM10TPM2.5EPM2.5DPM2.5TCO2eDaily, Summer(Max)—————————Avoided—————————Subtotal—————————Sequestered—————————Subtotal—————————Removed—————————Subtotal———————————————————Daily, Winter(Max)—————————Page 585 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202539 / 54Avoided—————————Subtotal—————————Sequestered—————————Subtotal—————————Removed—————————Subtotal———————————————————Annual—————————Avoided—————————Subtotal—————————Sequestered—————————Subtotal—————————Removed—————————Subtotal———————————————————5. Activity Data5.1. Construction SchedulePhase NamePhase TypeStart DateEnd DateDays Per WeekWork Days per PhasePhase DescriptionSite Preparation Site Preparation 3/23/2026 8/8/2026 6.00 120 —Grading Grading 3/30/2026 9/19/2026 6.00 150 —Paving Paving 9/20/2026 9/25/2026 6.00 5.00 —5.2. Off-Road Equipment5.2.1. UnmitigatedPhase NameEquipment TypeFuel TypeEngine TierNumber per DayHours Per DayHorsepowerLoad FactorPage 586 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202540 / 54Site Preparation Tractors/Loaders/Back Diesel Average 3.00 10.0 84.0 0.37Grading Excavators Diesel Average 10.0 10.0 36.0 0.38Grading Tractors/Loaders/BackhoesDiesel Average 3.00 10.0 84.0 0.37Paving Pavers Diesel Average 1.00 10.0 81.0 0.42Paving Paving Equipment Diesel Average 1.00 10.0 89.0 0.36Paving Rollers Diesel Average 1.00 10.0 36.0 0.38Paving Tractors/Loaders/BackhoesDiesel Average 1.00 10.0 84.0 0.375.2.2. MitigatedPhase NameEquipment TypeFuel TypeEngine TierNumber per DayHours Per DayHorsepowerLoad FactorSite Preparation Tractors/Loaders/BackhoesDiesel Tier 4 Final 3.00 10.0 84.0 0.37Grading Excavators Diesel Tier 4 Final 10.0 10.0 36.0 0.38Grading Tractors/Loaders/BackhoesDiesel Tier 4 Final 3.00 10.0 84.0 0.37Paving Pavers Diesel Tier 4 Final 1.00 10.0 81.0 0.42Paving Paving Equipment Diesel Tier 4 Final 1.00 10.0 89.0 0.36Paving Rollers Diesel Tier 4 Final 1.00 10.0 36.0 0.38Paving Tractors/Loaders/BackhoesDiesel Tier 4 Final 1.00 10.0 84.0 0.375.3. Construction Vehicles5.3.1. UnmitigatedPhase NameTrip TypeOne-Way Trips per DayMiles per TripVehicle MixSitePreparation————Site Preparation Worker 7.50 11.7 LDA,LDT1,LDT2Site Preparation Vendor — 8.40 HHDT,MHDTPage 587 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202541 / 54Site Preparation Hauling 0.00 20.0 HHDTSite Preparation Onsite truck — — HHDTGrading————Grading Worker 32.5 11.7 LDA,LDT1,LDT2Grading Vendor — 8.40 HHDT,MHDTGrading Hauling 0.00 20.0 HHDTGrading Onsite truck — — HHDTPaving————Paving Worker 10.0 11.7 LDA,LDT1,LDT2Paving Vendor — 8.40 HHDT,MHDTPaving Hauling 3.60 20.0 HHDTPaving Onsite truck — — HHDT5.3.2. MitigatedPhase NameTrip TypeOne-Way Trips per DayMiles per TripVehicle MixSitePreparation————Site Preparation Worker 7.50 11.7 LDA,LDT1,LDT2Site Preparation Vendor — 8.40 HHDT,MHDTSite Preparation Hauling 0.00 20.0 HHDTSite Preparation Onsite truck — — HHDTGrading————Grading Worker 32.5 11.7 LDA,LDT1,LDT2Grading Vendor — 8.40 HHDT,MHDTGrading Hauling 0.00 20.0 HHDTGrading Onsite truck — — HHDTPaving————Paving Worker 10.0 11.7 LDA,LDT1,LDT2Paving Vendor — 8.40 HHDT,MHDTPage 588 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202542 / 54Paving Hauling 3.60 20.0 HHDTPaving Onsite truck — — HHDT5.4. Vehicles5.4.1. Construction Vehicle Control StrategiesNon-applicable. No control strategies activated by user.5.5. Architectural CoatingsPhase NameResidential Interior AreaCoated (sq ft)Residential Exterior AreaCoated (sq ft)Non-Residential Interior AreaCoated (sq ft)Non-Residential Exterior AreaCoated (sq ft)Parking Area Coated (sq ft)5.6. Dust Mitigation5.6.1. Construction Earthmoving ActivitiesPhase NameMaterial Imported (cy)Material Exported (cy)Acres Graded (acres)Material Demolished (sq. ft.)Acres Paved (acres)Site Preparation — — 0.00 0.00 —Grading — — 0.00 0.00 —Paving 0.00 0.00 0.00 0.00 0.005.6.2. Construction Earthmoving Control StrategiesControl Strategies AppliedFrequency (per day)PM10 ReductionPM2.5 ReductionWater Exposed Area 2 61% 61%5.7. Construction PavingLand UseArea Paved (acres)% AsphaltGolf Course 0.00 0%Page 589 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202543 / 545.8. Construction Electricity Consumption and Emissions FactorskWh per Year and Emission Factor (lb/MWh)YearkWh per YearCO2CH4N2O2026 0.00 2.34 0.00 0.005.9. Operational Mobile Sources5.9.1. UnmitigatedLand Use TypeTrips/WeekdayTrips/SaturdayTrips/SundayTrips/YearVMT/WeekdayVMT/SaturdayVMT/SundayVMT/YearGolf Course 328 328 328 119,678 2,831 2,831 2,831 1,033,2285.9.2. MitigatedLand Use TypeTrips/WeekdayTrips/SaturdayTrips/SundayTrips/YearVMT/WeekdayVMT/SaturdayVMT/SundayVMT/YearGolf Course 328 328 328 119,678 2,831 2,831 2,831 1,033,2285.10. Operational Area Sources5.10.1. Hearths5.10.1.1. Unmitigated5.10.1.2. Mitigated5.10.2. Architectural CoatingsResidential Interior Area Coated (sqft)Residential Exterior Area Coated (sqft)Non-Residential Interior Area Coated(sq ft)Non-Residential Exterior AreaCoated (sq ft)Parking Area Coated (sq ft)0 0.00 0.00 0.00 —Page 590 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202544 / 545.10.3. Landscape EquipmentSeasonUnitValueSnow Days day/yr 0.00Summer Days day/yr 1805.10.4. Landscape Equipment - MitigatedSeasonUnitValueSnow Days day/yr 0.00Summer Days day/yr 1805.11. Operational Energy Consumption5.11.1. UnmitigatedElectricity (kWh/yr) and CO2 and CH4 and N2O and Natural Gas (kBTU/yr)Land UseElectricity (kWh/yr)CO2CH4N2ONatural Gas (kBTU/yr)Golf Course 0.00 2.34 0.0000 0.0000 0.005.11.2. MitigatedElectricity (kWh/yr) and CO2 and CH4 and N2O and Natural Gas (kBTU/yr)Land UseElectricity (kWh/yr)CO2CH4N2ONatural Gas (kBTU/yr)Golf Course 0.00 2.34 0.0000 0.0000 0.005.12. Operational Water and Wastewater Consumption5.12.1. UnmitigatedLand UseIndoor Water (gal/year)Outdoor Water (gal/year)Golf Course 0.00 0.00Page 591 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202545 / 545.12.2. MitigatedLand UseIndoor Water (gal/year)Outdoor Water (gal/year)Golf Course 0.00 0.005.13. Operational Waste Generation5.13.1. UnmitigatedLand UseWaste (ton/year)Cogeneration (kWh/year)Golf Course 81.5 —5.13.2. MitigatedLand UseWaste (ton/year)Cogeneration (kWh/year)Golf Course 81.5 —5.14. Operational Refrigeration and Air Conditioning Equipment5.14.1. UnmitigatedLand Use TypeEquipment TypeRefrigerantGWPQuantity (kg)Operations Leak RateService Leak RateTimes ServicedGolf Course Other commercial A/Cand heat pumpsR-410A 2,088 < 0.005 4.00 4.00 18.0Golf Course Stand-alone retailrefrigerators andfreezersR-134a 1,430 0.04 1.00 0.00 1.005.14.2. MitigatedLand Use TypeEquipment TypeRefrigerantGWPQuantity (kg)Operations Leak RateService Leak RateTimes ServicedGolf Course Other commercial A/Cand heat pumpsR-410A 2,088 < 0.005 4.00 4.00 18.0Page 592 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202546 / 54Golf Course Stand-alone retailrefrigerators andfreezersR-134a 1,430 0.04 1.00 0.00 1.005.15. Operational Off-Road Equipment5.15.1. UnmitigatedEquipment TypeFuel TypeEngine TierNumber per DayHours Per DayHorsepowerLoad Factor5.15.2. MitigatedEquipment TypeFuel TypeEngine TierNumber per DayHours Per DayHorsepowerLoad Factor5.16. Stationary Sources5.16.1. Emergency Generators and Fire PumpsEquipment TypeFuel TypeNumber per DayHours per DayHours per YearHorsepowerLoad Factor5.16.2. Process BoilersEquipment TypeFuel TypeNumberBoiler Rating (MMBtu/hr)Daily Heat Input (MMBtu/day)Annual Heat Input (MMBtu/yr)5.17. User DefinedEquipment TypeFuel Type5.18. Vegetation5.18.1. Land Use Change5.18.1.1. UnmitigatedPage 593 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202547 / 54Vegetation Land Use Type Vegetation Soil Type Initial Acres Final Acres5.18.1.2. MitigatedVegetation Land Use TypeVegetation Soil TypeInitial AcresFinal Acres5.18.1. Biomass Cover Type5.18.1.1. UnmitigatedBiomass Cover TypeInitial AcresFinal Acres5.18.1.2. MitigatedBiomass Cover TypeInitial AcresFinal Acres5.18.2. Sequestration5.18.2.1. UnmitigatedTree TypeNumberElectricity Saved (kWh/year)Natural Gas Saved (btu/year)5.18.2.2. MitigatedTree TypeNumberElectricity Saved (kWh/year)Natural Gas Saved (btu/year)6. Climate Risk Detailed Report6.1. Climate Risk SummaryCal-Adapt midcentury 2040–2059 average projections for four hazards are reported below for your project location. These are under Representation Concentration Pathway (RCP) 8.5 whichassumes GHG emissions will continue to rise strongly through 2050 and then plateau around 2100.Climate HazardResult for Project LocationUnitPage 594 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202548 / 54Temperature and Extreme Heat 12.6 annual days of extreme heatExtreme Precipitation 5.85 annual days with precipitation above 20 mmSea Level Rise — meters of inundation depthWildfire 0.00 annual hectares burnedTemperature and Extreme Heat data are for grid cell in which your project are located. The projection is based on the 98th historical percentile of daily maximum/minimum temperatures fromobserved historical data (32 climate model ensemble from Cal-Adapt, 2040–2059 average under RCP 8.5). Each grid cell is 6 kilometers (km) by 6 km, or 3.7 miles (mi) by 3.7 mi.Extreme Precipitation data are for the grid cell in which your project are located. The threshold of 20 mm is equivalent to about ¾ an inch of rain, which would be light to moderate rainfall ifreceived over a full day or heavy rain if received over a period of 2 to 4 hours. Each grid cell is 6 kilometers (km) by 6 km, or 3.7 miles (mi) by 3.7 mi.Sea Level Rise data are for the grid cell in which your project are located. The projections are from Radke et al. (2017), as reported in Cal-Adapt (Radkeet al., 2017, CEC-500-2017-008), andconsider inundation location and depth for the San Francisco Bay, the Sacramento-San Joaquin River Delta and California coast resulting different increments of sea level rise coupled withextreme storm events. Users may select from four scenarios to view the range in potential inundation depth for the grid cell. The four scenarios are: Norise, 0.5 meter, 1.0 meter, 1.41 metersWildfire data are for the grid cell in which your project are located. The projections are from UC Davis, as reported in Cal-Adapt (2040–2059 average under RCP 8.5), and consider historical dataof climate, vegetation, population density, and large (> 400 ha) fire history. Users may select from four model simulations to view the range in potential wildfire probabilities for the grid cell. Thefour simulations make different assumptions about expected rainfall and temperature are: Warmer/drier (HadGEM2-ES), Cooler/wetter (CNRM-CM5),Average conditions (CanESM2), Range ofdifferent rainfall and temperature possibilities (MIROC5). Each grid cell is 6 kilometers (km) by 6 km, or 3.7 miles (mi) by 3.7 mi.6.2. Initial Climate Risk ScoresClimate HazardExposure ScoreSensitivity ScoreAdaptive Capacity ScoreVulnerability ScoreTemperature and Extreme Heat N/A N/A N/A N/AExtreme Precipitation N/A N/A N/A N/ASea Level Rise N/A N/A N/A N/AWildfire N/A N/A N/A N/AFlooding N/A N/A N/A N/ADrought N/A N/A N/A N/ASnowpack Reduction N/A N/A N/A N/AAir Quality Degradation000N/AThe sensitivity score reflects the extent to which a project would be adversely affected by exposure to a climate hazard. Exposure is rated on a scale of1 to 5, with a score of 5 representing thegreatest exposure.The adaptive capacity of a project refers to its ability to manage and reduce vulnerabilities from projected climate hazards. Adaptive capacity is rated on a scale of 1 to 5, with a score of 5representing the greatest ability to adapt.The overall vulnerability scores are calculated based on the potential impacts and adaptive capacity assessments for each hazard. Scores do not include implementation of climate risk reductionmeasures.6.3. Adjusted Climate Risk ScoresPage 595 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202549 / 54Climate Hazard Exposure Score Sensitivity Score Adaptive Capacity Score Vulnerability ScoreTemperature and Extreme Heat N/A N/A N/A N/AExtreme Precipitation N/A N/A N/A N/ASea Level Rise N/A N/A N/A N/AWildfire N/A N/A N/A N/AFlooding N/A N/A N/A N/ADrought N/A N/A N/A N/ASnowpack Reduction N/A N/A N/A N/AAir Quality Degradation1112The sensitivity score reflects the extent to which a project would be adversely affected by exposure to a climate hazard. Exposure is rated on a scale of1 to 5, with a score of 5 representing thegreatest exposure.The adaptive capacity of a project refers to its ability to manage and reduce vulnerabilities from projected climate hazards. Adaptive capacity is rated on a scale of 1 to 5, with a score of 5representing the greatest ability to adapt.The overall vulnerability scores are calculated based on the potential impacts and adaptive capacity assessments for each hazard. Scores include implementation of climate risk reductionmeasures.6.4. Climate Risk Reduction Measures7. Health and Equity Details7.1. CalEnviroScreen 4.0 ScoresThe maximum CalEnviroScreen score is 100. A high score (i.e., greater than 50) reflects a higher pollution burden compared to other census tracts in the state.IndicatorResult for Project Census TractExposure Indicators—AQ-Ozone22.2AQ-PM11.3AQ-DPM53.2Drinking Water22.7Lead Risk Housing16.3Pesticides0.00Toxic Releases35.4Page 596 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202550 / 54Traffic80.8Effect Indicators—CleanUp Sites27.5Groundwater44.3Haz Waste Facilities/Generators 81.9Impaired Water Bodies33.2Solid Waste0.00Sensitive Population—Asthma2.08Cardio-vascular1.81Low Birth Weights80.0Socioeconomic Factor Indicators —Education2.71Housing23.4Linguistic25.6Poverty4.27Unemployment70.07.2. Healthy Places Index ScoresThe maximum Health Places Index score is 100. A high score (i.e., greater than 50) reflects healthier community conditions compared to other census tracts in the state.IndicatorResult for Project Census TractEconomic—Above Poverty94.21275504Employed79.36609778Median HI97.36943411Education—Bachelor's or higher95.90658283High school enrollment100Page 597 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202551 / 54Preschool enrollment91.10740408Transportation—Auto Access91.71050943Active commuting3.284999358Social—2-parent households91.74900552Voting98.02386757Neighborhood—Alcohol availability71.35891184Park access37.43102785Retail density27.34505325Supermarket access53.99717695Tree canopy89.95252149Housing—Homeownership95.79109457Housing habitability87.97638907Low-inc homeowner severe housing cost burden 38.35493392Low-inc renter severe housing cost burden 76.90234826Uncrowded housing91.95431798Health Outcomes—Insured adults98.216348Arthritis0.0Asthma ER Admissions97.3High Blood Pressure0.0Cancer (excluding skin)0.0Asthma0.0Coronary Heart Disease 0.0Chronic Obstructive Pulmonary Disease 0.0Page 598 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202552 / 54Diagnosed Diabetes0.0Life Expectancy at Birth69.8Cognitively Disabled68.5Physically Disabled52.4Heart Attack ER Admissions 97.8Mental Health Not Good0.0Chronic Kidney Disease0.0Obesity0.0Pedestrian Injuries53.0Physical Health Not Good 0.0Stroke0.0Health Risk Behaviors—Binge Drinking0.0Current Smoker0.0No Leisure Time for Physical Activity 0.0Climate Change Exposures —Wildfire Risk0.0SLR Inundation Area0.0Children87.9Elderly7.1English Speaking68.7Foreign-born46.7Outdoor Workers95.3Climate Change Adaptive Capacity —Impervious Surface Cover 76.1Traffic Density79.5Traffic Access52.4Other Indices—Page 599 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202553 / 54Hardship3.5Other Decision Support—2016 Voting97.27.3. Overall Health & Equity ScoresMetricResult for Project Census TractCalEnviroScreen 4.0 Score for Project Location (a) 15.0Healthy Places Index Score for Project Location (b) 98.0Project Located in a Designated Disadvantaged Community (Senate Bill 535) NoProject Located in a Low-Income Community (Assembly Bill 1550) NoProject Located in a Community Air Protection Program Community (Assembly Bill 617) Noa: The maximum CalEnviroScreen score is 100. A high score (i.e., greater than 50) reflects a higher pollution burden compared to other census tracts inthe state.b: The maximum Health Places Index score is 100. A high score (i.e., greater than 50) reflects healthier community conditions compared to other censustracts in the state.7.4. Health & Equity MeasuresNo Health & Equity Measures selected.7.5. Evaluation ScorecardHealth & Equity Evaluation Scorecard not completed.7.6. Health & Equity Custom MeasuresNo Health & Equity Custom Measures created.8. User Changes to Default DataScreenJustificationCharacteristics: Utility Information Los Gatos default clean energy provider is Silicon Valley Clean Energy.Construction: Construction Phases Start date and number of workdays/6days construction provided from filled out constructionworksheet.Construction: Off-Road Equipment Information from filled out construction worksheet.Construction: Trips and VMT Paving = 8,000-sf of asphalt (3.6 trips/day).Page 600 25-007 La Rinconada Country Club, Los Gatos BMPs T4F Detailed Report, 1/28/202554 / 54Construction: On-Road Fugitive Dust Air District BMPS 15 mph required by Los Gatos GP.Operations: Water and Waste Water —Page 601 2. Emissions Summary - HRA 2.2 Construction Emissions by Year, Unmitigated Year ROG NOx PM10E PM10D PM10T PM2.5E PM2.5D PM2.5T CO₂e Daily - Summer (Max) 2026 2.0500416 18.051759 0.55828300.02826140.58654450.5136203 0.0066244 0.52024483997.879216988345 Daily - Winter (Max) 2026 2.0447505 18.058814 0.55828300.02826140.58654450.5136203 0.0066244 0.52024483996.18528387456 Average Daily 2026 0.8155560 7.1806884 0.22204490.01122830.23327320.2042815 0.0026322 0.20691381570.2631597069865 Annual 2026 0.1488389 1.3104756 0.04052320.00204910.04257230.0372813 0.0004803 0.0377617259.97498584474874 Page 602 5.3. Construction Vehicles - HRA 5.3.1 Unmitigated Phase Name Trip Type One-Way Trips per Day Miles per Trip Vehicle Mix Site Preparation Site Preparation Worker 7.5 1 LDA,LDT1,LDT2 Site Preparation Vendor 1 HHDT,MHDT Site Preparation Hauling 0 1 HHDT Site Preparation Onsite truck HHDT Grading Grading Worker 32.5 1 LDA,LDT1,LDT2 Grading Vendor 1 HHDT,MHDT Grading Hauling 0 1 HHDT Grading Onsite truck HHDT Paving Paving Worker 10 1 LDA,LDT1,LDT2 Paving Vendor 1 HHDT,MHDT Paving Hauling 3.6 1 HHDT Paving Onsite truck HHDT Page 603 Attachment 2: Project Construction Dispersion Modeling Inputs and Risk Calculations Page 604 La Rinconada Country Club, Los Gatos, CA Construction Health Impact Summary Maximum Impacts at MEI Location - Without Mitigation Maximum Concentrations Maximum Exhaust Fugitive Hazard Annual PM2.5 Emissions PM10/DPM PM2.5 Index Concentration Year (μg/m3)(μg/m3)Infant/Child (-)(μg/m3) 2026 0.0118 0.0002 2.10 0.00 0.01 Total --2.10 - Maximum 0.0118 0.0002 -0.00 0.01 Maximum Impacts at Roxbury Elderly Care Unmitigated Emissions Maximum Concentrations Maximum Exhaust Fugitive Child Annual PM2.5 Construction PM10/DPM PM2.5 Cancer Risk Concentration Year (μg/m3)(μg/m3)(per million)(μg/m3) 2026 0.0013 0.0000 0.004 0.001 Total --0.004 - Maximum 0.0013 0.0000 -0.001 Cancer Risk (per million) Page 605 La Rinconada Country Club, Los Gatos, CA La Rinconada Country Club, Los Gatos, CA DPM Emissions and Modeling Emission Rates - Unmitigated PM2.5 Fugitive Dust Emissions for Modeling - Unmitigated DPM PM2.5Modeled Emission Modeled Emission Construction DPM Area DPM Emissions Area Rate Construction Area PM2.5 Emissions Area Rate Year Activity (ton/year) Source (lb/yr) (lb/hr) (g/s)(m2)(g/s/m2)Year Activity Source (ton/year) (lb/yr) (lb/hr) (g/s)(m2)g/s/m2 2026 Construction 0.0405 CON_DPM 81.0 0.02969 3.74E-03 394,139 9.49E-09 2026 Construction CON_FUG 0.0005 1.0 0.00035 4.43E-05 394,139 1.13E-10 Total 0.0405 81.0 0.0297 0.0037 Total 0.0005 1.0 0.0004 0.0000 Construction Hours Construction Hours hr/day = 10.5 (7am - 5:30pm)hr/day = 10.5 (7am - 5:30pm) days/yr = 260 days/yr = 260 hours/year = 2730 hours/year = 2730 Page 606 La Rinconada Country Club, Los Gatos, CA - Construction Impacts - Without Mitigation Maximum DPM Cancer Risk and PM2.5 Calculations From Construction Impacts at Off-Site MEI Location - 1.5 meter receptor height Cancer Risk (per million) = CPF x Inhalation Dose x ASF x ED/AT x FAH x 1.0E6 Where: CPF = Cancer potency factor (mg/kg-day)-1 ASF = Age sensitivity factor for specified age group ED = Exposure duration (years) AT = Averaging time for lifetime cancer risk (years) FAH = Fraction of time spent at home (unitless) Inhalation Dose = Cair x DBR x A x (EF/365) x 10-6 Where: Cair = concentration in air (μg/m3) DBR = daily breathing rate (L/kg body weight-day) A = Inhalation absorption factor EF = Exposure frequency (days/year) 10-6 = Conversion factor Values Infant/Child Adult Age --> 3rd Trimester 0 - 2 2 - 16 16 - 30 Parameter ASF = 10 10 3 1 CPF = 1.10E+00 1.10E+00 1.10E+00 1.10E+00 DBR* = 361 1090 572 261 A = 1 1 1 1 EF = 350 350 350 350 AT = 70 70 70 70 FAH =1.00 1.00 1.00 0.73 * 95th percentile breathing rates for infants and 80th percentile for children and adults Construction Cancer Risk by Year - Maximum Impact Receptor Location Infant/Child - Exposure Information Infant/Child Adult - Exposure Information Adult Exposure Age Cancer Modeled Age Cancer Maximum Exposure Duration DPM Conc (ug/m3) Sensitivity Risk DPM Conc (ug/m3) Sensitivity Risk Hazard Fugitive Total Year (years) Age Year Annual Factor (per million) Year Annual Factor (per million) Index PM2.5 PM2.5 0 0.25 -0.25 - 0* 2026 0.0118 10 0.16 2026 0.0118 - - 1 1 0 - 1 2026 0.0118 10 1.94 2026 0.0118 1 0.03 0.00 0.000 0.01 2 1 1 - 2 0.0000 10 0.00 0.0000 1 0.00 3 1 2 - 3 0.0000 3 0.00 0.0000 1 0.00 4 1 3 - 4 0.0000 3 0.00 0.0000 1 0.00 5 1 4 - 5 0.0000 3 0.00 0.0000 1 0.00 6 1 5 - 6 0.0000 3 0.00 0.0000 1 0.00 7 1 6 - 7 0.0000 3 0.00 0.0000 1 0.00 8 1 7 - 8 0.0000 3 0.00 0.0000 1 0.00 9 1 8 - 9 0.0000 3 0.00 0.0000 1 0.00 10 1 9 - 10 0.0000 3 0.00 0.0000 1 0.00 11 1 10 - 11 0.0000 3 0.00 0.0000 1 0.00 12 1 11 - 12 0.0000 3 0.00 0.0000 1 0.00 13 1 12 - 13 0.0000 3 0.00 0.0000 1 0.00 14 1 13 - 14 0.0000 3 0.00 0.0000 1 0.00 15 1 14 - 15 0.0000 3 0.00 0.0000 1 0.00 16 1 15 - 16 0.0000 3 0.00 0.0000 1 0.00 17 1 16-17 0.0000 1 0.00 0.0000 1 0.00 18 1 17-18 0.0000 1 0.00 0.0000 1 0.00 19 1 18-19 0.0000 1 0.00 0.0000 1 0.00 20 1 19-20 0.0000 1 0.00 0.0000 1 0.00 21 1 20-21 0.0000 1 0.00 0.0000 1 0.00 22 1 21-22 0.0000 1 0.00 0.0000 1 0.00 23 1 22-23 0.0000 1 0.00 0.0000 1 0.00 24 1 23-24 0.0000 1 0.00 0.0000 1 0.00 25 1 24-25 0.0000 1 0.00 0.0000 1 0.00 26 1 25-26 0.0000 1 0.00 0.0000 1 0.00 27 1 26-27 0.0000 1 0.00 0.0000 1 0.00 28 1 27-28 0.0000 1 0.00 0.0000 1 0.00 29 1 28-29 0.0000 1 0.00 0.0000 1 0.00 30 1 29-30 0.0000 1 0.00 0.0000 1 0.00 Total Increased Cancer Risk 2.10 0.03 * Third trimester of pregnancy Page 607 La Rinconada Country Club, Los Gatos, CA - Construction Impacts - Without Mitigation Maximum DPM Cancer Risk and PM2.5 Calculations From Construction Impacts at Roxbury Elderly Care - 1.5 meter receptor height Cancer Risk (per million) = CPF x Inhalation Dose x ASF x ED/AT x FAH x 1.0E6 Where: CPF = Cancer potency factor (mg/kg-day)-1 ASF = Age sensitivity factor for specified age group ED = Exposure duration (years) AT = Averaging time for lifetime cancer risk (years) FAH = Fraction of time spent at home (unitless) Inhalation Dose = Cair x DBR x A x (EF/365) x 10-6 Where: Cair = concentration in air (μg/m3) DBR = daily breathing rate (L/kg body weight-day) A = Inhalation absorption factor EF = Exposure frequency (days/year) 10-6 = Conversion factor Values Infant/Child Adult Age -->3rd Trimester 0 - 2 2 - 16 16 - 30 Parameter ASF = 10 10 3 1 CPF = 1.10E+00 1.10E+00 1.10E+00 1.10E+00 DBR* = 361 1090 572 261 A = 1 1 1 1 EF = 350 350 350 350 AT = 70 70 70 70 FAH =1.00 1.00 1.00 0.73 * 95th percentile breathing rates for infants and 80th percentile for children and adults Construction Cancer Risk by Year - Maximum Impact Receptor Location Adult - Exposure Information Adult Exposure Modeled Age Cancer Maximum Exposure Duration DPM Conc (ug/m3)Sensitivity Risk Hazard Fugitive Total Year (years)Age Year Annual Factor (per million)Index PM2.5 PM2.5 0 0.25 -0.25 - 0* 2026 0.0013 - - 1 1 0 - 1 2026 0.0013 1 0.00 0.00 0.000 0.00 2 1 1 - 2 0.0000 1 0.00 3 1 2 - 3 0.0000 1 0.00 4 1 3 - 4 0.0000 1 0.00 5 1 4 - 5 0.0000 1 0.00 6 1 5 - 6 0.0000 1 0.00 7 1 6 - 7 0.0000 1 0.00 8 1 7 - 8 0.0000 1 0.00 9 1 8 - 9 0.0000 1 0.00 10 1 9 - 10 0.0000 1 0.00 11 1 10 - 11 0.0000 1 0.00 12 1 11 - 12 0.0000 1 0.00 13 1 12 - 13 0.0000 1 0.00 14 1 13 - 14 0.0000 1 0.00 15 1 14 - 15 0.0000 1 0.00 16 1 15 - 16 0.0000 1 0.00 17 1 16-17 0.0000 1 0.00 18 1 17-18 0.0000 1 0.00 19 1 18-19 0.0000 1 0.00 20 1 19-20 0.0000 1 0.00 21 1 20-21 0.0000 1 0.00 22 1 21-22 0.0000 1 0.00 23 1 22-23 0.0000 1 0.00 24 1 23-24 0.0000 1 0.00 25 1 24-25 0.0000 1 0.00 26 1 25-26 0.0000 1 0.00 27 1 26-27 0.0000 1 0.00 28 1 27-28 0.0000 1 0.00 29 1 28-29 0.0000 1 0.00 30 1 29-30 0.0000 1 0.00 Total Increased Cancer Risk 0.00 * Third trimester of pregnancy Page 608 Attachment 3: Cumulative Health Risk Screening and Calculations from Existing TAC Sources BAAQMD Roadway Raster Cancer Risk at MEI Page 609 BAAQMD Roadway Raster Annual PM2.5 Concentration at MEI Page 610 BAAQMD Roadway Raster Hazard Index at MEI Page 611 Screening Report Area of Interest (AOI) Information Area : 20,703,981.53 ft² Jan 21 2025 13:46:44 Pacific Standard Time 1/21/25, 1:47 PM about:blank about:blank 1/2 Page 612 Summary Name Count Area(ft²) Length(ft) Permitted Stationary Sources 1 N/A N/A Permitted Stationary Sources # Address Cancer_Ris Chronic_Ha City County 1 17445 Zena Ave 0.73 0.00 Monte Sereno Santa Clara # Details Facility_I Facility_N Latitude Longitude 1 Gas Dispensing Facility 106600-1 La Rinconada Country Club 37.26 -121.98 # NAICS NAICS_Indu NAICS_Sect NAICS_Subs PM25 1 713910 Golf Courses and Country Clubs Arts, Entertainment, and Recreation Amusement, Gambling, and Recreation Industries 0.00 # State Zip Count 1 CA 95030 1 NOTE: A larger buffer than 1,000 may be warranted depending on proximity to significant sources. 1/21/25, 1:47 PM about:blank about:blank 2/2 Page 613 LA RINCONADA COUNTRY CLUB GOLF COURSE MODERNIZATION PROJECT CONSTRUCTION NOISE AND VIBRATION ASSESSMENT Los Gatos, California January 30, 2025 Prepared for: Patrick Kallas Project Manager David J. Powers & Associates, Inc. 1871 The Alameda, Suite 200 San José, CA 95126 Prepared by: Michael S. Thill Principal Consultant 429 East Cotati Avenue Cotati, CA 94931 (707) 794-0400 Project: 25-007 Page 614 1 INTRODUCTION This report addresses the potential for temporary noise or vibration impacts resulting from the La Rinconada Country Club Golf Course Modernization Project at 14595 Clearview Drive in Los Gatos, California. The report presents the project description and background information on environmental noise and vibration, the applicable regulatory criteria used in the assessment, and the evaluation of construction-related noise and vibration impacts. PROJECT DESCRIPTION Proposed Layout The proposed project would leave 17 of the 18 holes in their current locations. The only hole location that would be modified would be the 13th hole, which would move from the edge of the project site to an internal location on the south side of the project site. All existing on-site structures would remain unchanged. Upon project completion, the Country Club would continue to operate one 18-hole golf course on the property, and the membership numbers would remain unchanged. The proposed project would not expand or increase the use of any facilities at La Rinconada Country Club. The proposed project would not alter ingress and egress to the property. Irrigation System and Cart Paths As part of the proposed project, the irrigation system would be modernized; on-site drainage systems would be upgraded; and the fairway grass would be replaced with a modern hybrid bermudagrass that requires 35 percent less irrigation water than the current course grass. In addition to the turf change and drainage upgrades, the proposed project would replace most of the existing golf course cart paths with reduced footprint cart paths. Replacement of the cart paths would reduce impervious surfaces on the golf course by approximately 70 percent. Tree Removal There are approximately 1,200 trees on the property, most of which are non-native species planted by the Club over the past 50 years. Recently introduced redwoods and eucalyptus trees would be replaced by native oaks as a part of the proposed project. The plan would remove approximately 240 trees, most of which are redwoods and eucalyptus. The proposed project would replace the trees removed at a one-to-one ratio, planting approximately 240 native oak trees on the golf course. This would restore the property to a more natural state similar to the late 1920’s. Construction As part of construction activities, grading would be balanced on-site with approximately 52,780 cubic yards of cut and fill. No soil would be imported to or exported from the site. Construction of the proposed project is estimated to take approximately seven months to complete and is scheduled to begin in late March of 2026. Page 615 2 SETTING Fundamentals of Environmental Noise Noise may be defined as unwanted sound. Noise is usually objectionable because it is disturbing or annoying. The objectionable nature of sound could be caused by its pitch or its loudness. Pitch is the height or depth of a tone or sound, depending on the relative rapidity (frequency) of the vibrations by which it is produced. Higher pitched signals sound louder to humans than sounds with a lower pitch. Loudness is intensity of sound waves combined with the reception characteristics of the ear. Intensity may be compared with the height of an ocean wave in that it is a measure of the amplitude of the sound wave. In addition to the concepts of pitch and loudness, there are several noise measurement scales which are used to describe noise in a particular location. A decibel (dB) is a unit of measurement which indicates the relative amplitude of a sound. The zero on the decibel scale is based on the lowest sound level that the healthy, unimpaired human ear can detect. Sound levels in decibels are calculated on a logarithmic basis. An increase of 10 decibels represents a ten-fold increase in acoustic energy, while 20 decibels is 100 times more intense, 30 decibels is 1,000 times more intense, etc. There is a relationship between the subjective noisiness or loudness of a sound and its intensity. Each 10 decibel increase in sound level is perceived as approximately a doubling of loudness over a fairly wide range of intensities. Technical terms are defined in Table 1. There are several methods of characterizing sound. The most common in California is the A- weighted sound level (dBA). This scale gives greater weight to the frequencies of sound to which the human ear is most sensitive. Representative outdoor and indoor noise levels in units of dBA are shown in Table 2. Because sound levels can vary markedly over a short period of time, a method for describing either the average character of the sound or the statistical behavior of the variations must be utilized. Most commonly, environmental sounds are described in terms of an average level that has the same acoustical energy as the summation of all the time-varying events. This energy-equivalent sound/noise descriptor is called Leq. The most common averaging period is hourly, but Leq can describe any series of noise events of arbitrary duration. The scientific instrument used to measure noise is the sound level meter. Sound level meters can accurately measure environmental noise levels to within plus or minus 1 dBA. Various computer models are used to predict environmental noise levels from sources, such as roadways and airports. The accuracy of the predicted models depends upon the distance the receptor is from the noise source. Close to the noise source, the models are accurate to within about plus or minus 1 to 2 dBA. Page 616 3 TABLE 1 Definition of Acoustical Terms Used in this Report Term Definition Decibel, dB A unit describing the amplitude of sound, equal to 20 times the logarithm to the base 10 of the ratio of the pressure of the sound measured to the reference pressure. The reference pressure for air is 20 micro Pascals. Sound Pressure Level Sound pressure is the sound force per unit area, usually expressed in micro Pascals (or 20 micro Newtons per square meter), where 1 Pascal is the pressure resulting from a force of 1 Newton exerted over an area of 1 square meter. The sound pressure level is expressed in decibels as 20 times the logarithm to the base 10 of the ratio between the pressures exerted by the sound to a reference sound pressure (e. g., 20 micro Pascals). Sound pressure level is the quantity that is directly measured by a sound level meter. Frequency, Hz The number of complete pressure fluctuations per second above and below atmospheric pressure. Normal human hearing is between 20 Hz and 20,000 Hz. Infrasonic sound are below 20 Hz and Ultrasonic sounds are above 20,000 Hz. A-Weighted Sound Level, dBA The sound pressure level in decibels as measured on a sound level meter using the A-weighting filter network. The A-weighting filter de-emphasizes the very low and very high frequency components of the sound in a manner similar to the frequency response of the human ear and correlates well with subjective reactions to noise. Equivalent Noise Level, Leq The average A-weighted noise level during the measurement period. Lmax, Lmin The maximum and minimum A-weighted noise level during the measurement period. L01, L10, L50, L90 The A-weighted noise levels that are exceeded 1%, 10%, 50%, and 90% of the time during the measurement period. Day/Night Noise Level, Ldn or DNL The average A-weighted noise level during a 24-hour day, obtained after addition of 10 decibels to levels measured in the night between 10:00 pm and 7:00 am. Community Noise Equivalent Level, CNEL The average A-weighted noise level during a 24-hour day, obtained after addition of 5 decibels in the evening from 7:00 pm to 10:00 pm and after addition of 10 decibels to sound levels measured in the night between 10:00 pm and 7:00 am. Ambient Noise Level The composite of noise from all sources near and far. The normal or existing level of environmental noise at a given location. Intrusive That noise which intrudes over and above the existing ambient noise at a given location. The relative intrusiveness of a sound depends upon its amplitude, duration, frequency, and time of occurrence and tonal or informational content as well as the prevailing ambient noise level. Source: Handbook of Acoustical Measurements and Noise Control, Harris, 1998. Page 617 4 TABLE 2 Typical Noise Levels in the Environment Common Outdoor Activities Noise Level (dBA) Common Indoor Activities 110 dBA Rock band Jet fly-over at 1,000 feet 100 dBA Gas lawn mower at 3 feet 90 dBA Diesel truck at 50 feet at 50 mph Food blender at 3 feet 80 dBA Garbage disposal at 3 feet Noisy urban area, daytime Gas lawn mower, 100 feet 70 dBA Vacuum cleaner at 10 feet Commercial area Normal speech at 3 feet Heavy traffic at 300 feet 60 dBA Large business office Quiet urban daytime 50 dBA Dishwasher in next room Quiet urban nighttime 40 dBA Theater, large conference room Quiet suburban nighttime 30 dBA Library Quiet rural nighttime Bedroom at night, concert hall (background) 20 dBA Broadcast/recording studio 10 dBA 0 dBA Source: Technical Noise Supplement (TeNS), California Department of Transportation, September 2013. Page 618 5 Fundamentals of Groundborne Vibration Ground vibration consists of rapidly fluctuating motions or waves with an average motion of zero. Several different methods are typically used to quantify vibration amplitude. One method is the Peak Particle Velocity (PPV). The PPV is defined as the maximum instantaneous positive or negative peak of the vibration wave. In this report, a PPV descriptor with units of mm/sec or in/sec is used to evaluate construction generated vibration for building damage and human complaints. Table 3 displays the reactions of people and the effects on buildings that continuous or frequent intermittent vibration levels produce. The guidelines in Table 3 represent syntheses of vibration criteria for human response and potential damage to buildings resulting from construction vibration. Construction activities can cause vibration that varies in intensity depending on several factors. The use of pile driving and vibratory compaction equipment typically generates the highest construction related groundborne vibration levels. Because of the impulsive nature of such activities, the use of the PPV descriptor has been routinely used to measure and assess groundborne vibration and almost exclusively to assess the potential of vibration to cause damage and the degree of annoyance for humans. The two primary concerns with construction-induced vibration, the potential to damage a structure and the potential to interfere with the enjoyment of life, are evaluated against different vibration limits. Human perception to vibration varies with the individual and is a function of physical setting and the type of vibration. Persons exposed to elevated ambient vibration levels, such as people in an urban environment, may tolerate a higher vibration level. Structural damage can be classified as cosmetic only, such as paint flaking or minimal extension of cracks in building surfaces; minor, including limited surface cracking; or major, that may threaten the structural integrity of the building. Safe vibration limits that can be applied to assess the potential for damaging a structure vary by researcher. The damage criteria presented in Table 3 include several categories for ancient, fragile, and historic structures, the types of structures most at risk to damage. Most buildings are included within the categories ranging from “Historic and some old buildings” to “Modern industrial/commercial buildings”. Construction-induced vibration that can be detrimental to the building is very rare and has only been observed in instances where the structure is at a high state of disrepair and the construction activity occurs immediately adjacent to the structure. The annoyance levels shown in Table 3 should be interpreted with care since vibration may be found to be annoying at lower levels than those shown, depending on the level of activity or the sensitivity of the individual. To sensitive individuals, vibrations approaching the threshold of perception can be annoying. Low-level vibrations frequently cause irritating secondary vibration, such as a slight rattling of windows, doors, or stacked dishes. The rattling sound can give rise to exaggerated vibration complaints, even though there is very little risk of actual structural damage. Page 619 6 TABLE 3 Reaction of People and Damage to Buildings from Continuous or Frequent Intermittent Vibration Levels Velocity Level, PPV (in/sec) Human Reaction Effect on Buildings 0.01 Barely perceptible No effect 0.04 Distinctly perceptible Vibration unlikely to cause damage of any type to any structure 0.08 Distinctly perceptible to strongly perceptible Recommended upper level of the vibration to which ruins and ancient monuments should be subjected 0.1 Strongly perceptible Threshold at which there is a risk of damage to fragile buildings with no risk of damage to most buildings 0.25 Strongly perceptible to severe Threshold at which there is a risk of damage to historic and some old buildings. 0.3 Strongly perceptible to severe Threshold at which there is a risk of damage to older residential structures 0.5 Severe - Vibrations considered unpleasant Threshold at which there is a risk of damage to new residential and modern commercial/industrial structures Source: Transportation and Construction Vibration Guidance Manual, California Department of Transportation, April 2020. Regulatory Background - Noise The State of California Environmental Quality Act (CEQA) Guidelines, Appendix G, are used to assess the potential significance of impacts pursuant to local General Plan policies, Municipal Code standards, or the applicable standards of other agencies. A summary of the applicable regulatory criteria is provided below. State of California State CEQA Guidelines. CEQA contains guidelines to evaluate the significance of effects of environmental noise attributable to a proposed project. Under CEQA, construction noise or vibration impacts would be considered significant if the project would result in: (a) Generation of a substantial temporary or permanent increase in ambient noise levels in the vicinity of the project in excess of standards established in the local General Plan or Noise Ordinance, or applicable standards of other agencies; (b) Generation of excessive groundborne vibration or groundborne noise levels; or Page 620 7 Town of Los Gatos Town of Los Gatos 2040 General Plan. The Town of Los Gatos identifies the following policies applicable to the proposed development: ENV 21 - Ensure that construction and maintenance equipment noise does not adversely affect land uses. ENV 21.1 Noise Attenuation, Town Equipment All Town-owned and operated construction and maintenance equipment, and equipment for these activities operated under contract with the Town, shall contain state-of-the-art noise attenuation equipment. ENV 21.2 Noise Attenuation, Private Equipment Monitor and modify Town ordinances, as appropriate, to control nuisance noise from maintenance equipment used in the community. Town of Los Gatos Code of Ordinances The Town Noise Ordinance (Chapter 16 of the Town Municipal Code) specifies noise limits to protect the peace, health, and safety of its citizens from such noise and vibration. The following policies would be applicable to the project. Sec. 16.20.035. - Construction (a) Notwithstanding any other provision of this chapter, between the hours of 8:00 a.m. to 6:00 p.m. weekdays, and 9:00 a.m. to 4:00 p.m. Saturdays, construction, alteration or repair activities which are authorized by a valid Town permit or as otherwise allowed by Town permit, shall be allowed if they meet at least one of the following noise limitations: (1) No individual piece of equipment shall produce a noise level exceeding eighty- five (85) dBA at twenty-five (25) feet. If the device is located within a structure on the property, the measurement shall be made at distances as close to twenty-five (25) feet from the device as possible. (2) The noise level at any point outside of the property plane shall not exceed eighty-five (85) dBA. Regulatory Background – Vibration California Department of Transportation. The California Department of Transportation recommends a vibration limit of 0.5 in/sec PPV for buildings structurally sound and designed to modern engineering standards, which typically consist of buildings constructed since the 1990s. Conservative vibration limits of 0.3 in/sec PPV is used for buildings that are found to be structurally sound but where structural damage is a major concern (see Table 3 above for further explanation). For historical buildings or some older buildings, a vibration limit of 0.25 in/sec PPV would apply. Page 621 8 NOISE IMPACTS AND AVOIDANCE MEASURES Significance Criteria The following criteria were used to evaluate the significance of noise and vibration resulting from the project: (a) Generation of a substantial temporary or permanent increase in ambient noise levels in the vicinity of the project in excess of standards established in the local general plan or noise ordinance, or applicable standards of other agencies; (b) Generation of excessive groundborne vibration or groundborne noise levels; Impact 1: Temporary Construction Noise. Existing receptors may temporarily be exposed to construction noise levels exceeding the Town of Los Gatos construction noise thresholds, but the short-term noise would result in a less-than-significant impact. For construction noise, the potential for noise impacts was assessed by considering several factors, including the proximity of Project-related noise sources to noise-sensitive land uses (i.e., “sensitive receptors”), typical noise levels associated with construction equipment, the potential for construction noise levels to interfere with daytime activities, the duration that sensitive receptors would be affected, and whether proposed activities would occur outside the construction time limits or noise limits established in the local ordinance. For purposes of this analysis, temporary exposure to noise during the daytime is generally not considered significant if it is for short durations even if the noise is above the thresholds discussed herein, which is based on the reasonable assumption that most people would expect and accept short-term noise associated with a nearby construction project. Construction of the proposed project is estimated to take approximately seven months to complete and is scheduled to begin in late March of 2026. Construction would progress sequentially from hole to hole; so, only portions of the property will experience construction activity at any single point in time during the construction period. In general, the modernization activity would last approximately two to four weeks per hole, depending on hole location. Proposed hours of construction are 7:00 a.m. to 5:30 p.m. on weekdays and 9:00 a.m. to 5:30 p.m. on Saturdays. No construction would occur on Sundays or holidays. Construction phases would include site preparation, grading/excavation, trenching/foundation, and paving. During each phase of construction, there would be a different mix of equipment operating, and noise levels would vary by phase and vary within phases, based on the amount of equipment in operation and the location at which the equipment is operating. Noise impacts resulting from construction depend upon the noise generated by various pieces of construction equipment, the timing and duration of noise-generating activities, and the distance between construction noise sources and noise-sensitive areas. Construction noise impacts primarily result when construction activities occur during noise-sensitive times of the day (e.g., Page 622 9 early morning, evening, or nighttime hours), the construction occurs in areas immediately adjoining noise-sensitive land uses, or when construction lasts over extended periods of time. The Town’s Code of Ordinances Section 16.20.035 limits construction activities to the hours of 8:00 a.m. to 6:00 p.m. on weekdays and between the hours of 9:00 a.m. and 4:00 p.m. on Saturdays. No construction is permitted on Sundays or holidays. Section 16.20.035 also states that at least one of the following conditions should be met; (1) construction noise limits of 85 dBA at a distance of 25 feet for any single piece of equipment and (2) noise level at any point outside of the property plane of the project site is limited to 85 dBA. Construction activities generate considerable amounts of noise, especially during earth-moving activities when heavy equipment is used. The hauling of excavated materials and construction materials would generate truck trips on local roadways, as well. For the proposed development, pile driving is not anticipated. The typical range of maximum instantaneous noise levels for the proposed project would be 70 to 90 dBA Lmax at a distance of 50 feet (see Table 4) from the equipment. Table 5 shows the hourly average noise level ranges, by construction phase, typical for various types of projects. Hourly average noise levels generated by construction are about 71 to 89 dBA Leq for recreation projects, measured at a distance of 50 feet from the center of a busy construction site. Construction-generated noise levels drop off at a rate of about 6 dBA per doubling of the distance between the source and receptor. Shielding by buildings or terrain often results in lower construction noise levels at distant receptors. Equipment expected to be used in each construction stage are summarized in Table 6, along with the quantity of each type of equipment and the reference noise level at 25 feet, assuming the operation of the two loudest pieces of construction equipment for each construction phase. Federal Highway Administration’s (FHWA’s) Roadway Construction Noise Model (RCNM) was used to calculate the hourly average noise levels for each phase of construction, assuming the two loudest pieces of equipment would operate simultaneously, as recommended by the FTA for construction noise evaluations. This construction noise model includes representative sound levels for the most common types of construction equipment and the approximate usage factors of such equipment that were developed based on an extensive database of information gathered during the construction of the Central Artery/Tunnel Project in Boston, Massachusetts (CA/T Project or "Big Dig"). The usage factors represent the percentage of time that the equipment would be operating at full power. Page 623 10 TABLE 4 Construction Equipment 50-foot Noise Emission Limits Equipment Category Lmax Level (dBA)1,2 Impact/Continuous Arc Welder Auger Drill Rig Backhoe Bar Bender Boring Jack Power Unit Chain Saw Compressor3 Compressor (other) Concrete Mixer Concrete Pump Concrete Saw Concrete Vibrator Crane Dozer Excavator Front End Loader Generator Generator (25 KVA or less) Gradall Grader Grinder Saw Horizontal Boring Hydro Jack Hydra Break Ram Impact Pile Driver Insitu Soil Sampling Rig Jackhammer Mounted Impact Hammer (hoe ram) Paver Pneumatic Tools Pumps Rock Drill Scraper Slurry Trenching Machine Soil Mix Drill Rig Street Sweeper Tractor Truck (dump, delivery) Vacuum Excavator Truck (vac-truck) Vibratory Compactor Vibratory Pile Driver All other equipment with engines larger than 5 HP 73 85 80 80 80 85 70 80 85 82 90 80 85 85 85 80 82 70 85 85 85 80 90 105 84 85 90 85 85 77 85 85 82 80 80 84 84 85 80 95 85 Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Impact Impact Continuous Impact Impact Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Continuous Notes: 1 Measured at 50 feet from the construction equipment, with a “slow” (1 sec.) time constant. 2 Noise limits apply to total noise emitted from equipment and associated components operating at full power while engaged in its intended operation. 3Portable Air Compressor rated at 75 cfm or greater and that operates at greater than 50 psi. Page 624 11 TABLE 5 Typical Ranges of Construction Noise Levels at 50 feet, Leq (dBA) Domestic Housing Office Building, Hotel, Hospital, School, Public Works Industrial Parking Garage, Religious Amusement & Recreations, Store, Service Station Public Works Roads & Highways, Sewers, and Trenches I II I II I II I II Ground Clearing 83 83 84 84 84 83 84 84 Excavation 88 75 89 79 89 71 88 78 Foundations 81 81 78 78 77 77 88 88 Erection 81 65 87 75 84 72 79 78 Finishing 88 72 89 75 89 74 84 84 I - All pertinent equipment present at site. II - Minimum required equipment present at site. Source: U.S.E.P.A., Legal Compilation on Noise, Vol. 1, p. 2-104, 1973. TABLE 6 Construction Noise Levels from Heavy Equipment at 25 feet Phase of Construction Total Number of Workdays Construction Equipment (Quantity) Maximum Noise Level at 25 feet, dBA Lmax Average Noise Level at 25 feet, dBA Leq Site Preparation 120 Tractor/Loader/Backhoe (3)a 90 87 Grading/ Excavation 150 Excavator (10) a Tractor/Loader/Backhoe (3) a 87 90 88 Paving 5 Paver (1)a Paving Equipment (1) Roller (1) Tractor/Loader/Backhoe (3) a 83 83 86 90 87 a Denotes two loudest pieces of construction equipment per phase. As shown in Table 6, construction noise levels would range from 87 to 88 dBA Leq when the two loudest pieces of construction equipment per phase operate 25 feet from an individual receptor. These predicted noise levels credibly represent worst-case conditions. Construction noise levels under credible worst-case conditions would be reduced to 84 to 85 dBA Leq when the two loudest pieces of construction equipment per phase operate 35 feet or further from an individual receptors. Page 625 12 The following best management practices are assumed: x Construction activities shall be limited to the hours of 8:00 a.m. to 6:00 p.m. on weekdays and between the hours of 9:00 a.m. and 4:00 p.m. on Saturdays. No construction is permitted on Sundays or holidays. x Equip all internal combustion engine-driven equipment with intake and exhaust mufflers that are in good condition and appropriate for the equipment. x Prohibit unnecessary idling of internal combustion engines. x Locate stationary noise-generating equipment, such as air compressors or portable power generators, as far as possible from sensitive receptors as feasible. If they must be located near receptors, adequate muffling (with enclosures where feasible and appropriate) shall be used to reduce noise levels at the adjacent sensitive receptors. Any enclosure openings or venting shall face away from sensitive receptors. x Locate construction staging areas at locations that will create the greatest distance between the construction-related noise sources and noise-sensitive receptors nearest the project site during all project construction. x Locate material stockpiles, as well as maintenance/equipment staging and parking areas, as far as feasible from residential receptors. x Designate a "disturbance coordinator" who would be responsible for responding to any complaints about construction noise. The disturbance coordinator will determine the cause of the noise complaint (e.g., bad muffler, etc.) and will require that reasonable measures be implemented to correct the problem. Conspicuously post a telephone number for the disturbance coordinator at the construction site and include in it the notice sent to neighbors regarding the construction schedule. The implementation of these reasonable controls would minimize disruption and annoyance at existing noise-sensitive receptors in the project vicinity. Considering that the modernization activity would last approximately two to four weeks per hole, and less than one construction season in total, and that the vast majority of construction would occur more than 35 feet from nearby receptors, the temporary exceedances of the Town’s Code of Ordinances would result in a less- than-significant impact. Impact 2: Exposure to Excessive Groundborne Vibration. Construction of the project would potentially generate vibration levels exceeding the 0.25 in/sec PPV threshold at historic homes adjoining the project site. The implementation of best management practices would reduce the potential impact to a less-than-significant level. The California Department of Transportation (Caltrans) recommends a vibration limit of 0.5 in/sec PPV for new residential and modern commercial/industrial structures, a vibration limit of 0.3 Page 626 13 in/sec PPV for older residential structures, and a vibration limit of 0.25 in/sec PPV for historic buildings. The Town recognizes a structure as historic if any one of the following apply: x Any structure / site that is located within an historic district x Any structure / site that is historically designated within the LHP overlay x Any primary structure constructed prior to 1941, unless the Town has specifically determined the structure has no historic significance or architectural merit. Based on the Town’s definition of historic structures, this analysis uses a vibration limit of 0.25 in/sec PPV to conservatively assess the potential for vibration impacts. Table 7 presents typical vibration levels that could be expected from construction equipment at a distance of 25 feet. Project construction activities, such as drilling, the use of jackhammers, rock drills, other high-power or vibratory tools, and rolling stock equipment (tracked vehicles, compactors, etc.), may generate substantial vibration in the immediate vicinity. Jackhammers typically generate vibration levels of 0.035 in/sec PPV, and drilling typically generates vibration levels of 0.09 in/sec PPV at a distance of 25 feet. Vibration levels would vary depending on soil conditions, construction methods, and equipment used. Vibration levels are highest close to the source and then attenuate with increasing distance from the source. Vibration levels at various distances can be calculated as follows1: PPVEquipment = PPVRef (25/D)n (in/sec) Where: PPVRef = reference PPV at 25 ft. D = distance from equipment to the receiver in ft. n = 1.1 ( the value related to the attenuation rate through ground) TABLE 7 Vibration Source Levels for Construction Equipment Equipment PPV at 25 ft. (in/sec) Minimum Distance to Meet 0.25 in/sec PPV (feet) Clam shovel drop 0.202 21 Hydromill (slurry wall) in soil 0.008 2 in rock 0.017 3 Vibratory Roller 0.210 21 Hoe Ram 0.089 10 Large bulldozer 0.089 10 Caisson drilling 0.089 10 Loaded trucks 0.076 9 Jackhammer 0.035 5 Small bulldozer 0.003 1 Source: Transit Noise and Vibration Impact Assessment Manual, Federal Transit Administration, Office of Planning and Environment, U.S. Department of Transportation, September 2018, as modified by Illingworth & Rodkin, Inc., January 2025. 1 Transportation and Construction Vibration Guidance Manual, California Department of Transportation, April 2020. Page 627 14 Table 8 provides a summary of vibration levels expected from project construction equipment in five-foot increments to show how vibration levels attenuate with distance from the source. The construction of the project would generate vibration levels exceeding the 0.25 in/sec PPV threshold at vibration-sensitive buildings when vibratory rollers are used within 25 feet. The 0.25 in/sec PPV threshold would also be exceeded at vibration-sensitive buildings when excavators are used within 10 feet. The use of small tractors/loaders/backhoes, pavers, and other paving equipment would not be expected to generate vibration levels exceeding the thresholds. TABLE 8 Construction Vibration Levels by Phase PPV (in/sec) at Various Distances from Construction Equipment Phase Construction Equipment 5 feet 10 feet 15 feet 20 feet 25 feet Site Preparation Tractor/Loader/Backhoe 0.018 0.008 0.005 0.004 0.003 Grading / Excavation Excavator Tractor/Loader/Backhoe 0.446 0.018 0.208 0.008 0.133 0.005 0.097 0.004 0.076 0.003 Paving Paver Paving Equipment Roller Tractor/Loader/Backhoe 0.018 0.018 1.233 0.018 0.008 0.008 0.575 0.008 0.005 0.005 0.368 0.005 0.004 0.004 0.268 0.004 0.003 0.003 0.210 0.003 Source: Transit Noise and Vibration Impact Assessment Manual, Federal Transit Administration, Office of Planning and Environment, U.S. Department of Transportation, September 2018, as modified by Illingworth & Rodkin, Inc., January 2025. The following best management practices are assumed in this analysis: x Smaller equipment (less than 18,000 pounds) shall be used near the property lines adjacent to the residential buildings to minimize vibration levels. For example, a smaller vibratory roller similar to a Caterpillar model CP433E vibratory compactor could be used when compacting materials within 25 feet of vibration-sensitive buildings. Small tractors/loaders/backhoes shall be used within 10 feet of vibration-sensitive buildings instead of excavators. x Designate a Disturbance Coordinator responsible for registering and investigating claims of excessive vibration. The contact information of such person shall be clearly posted on the construction site. The implementation of these best management practices would reduce the potential vibration impact to a less-than-significant level. Page 628 January 24, 2025 Dear Neighbor: Happy New Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We are now looking forward to investing for the next generation. Over the past several years, we have been planning a golf course modernization project that will make us more environmentally sustainable, responsible, and enjoyable for future generations. While the fairways, greens and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early to share our plans, answer any questions and try to address any concerns you may have. Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised and irrigation and drainage, especially around greens and bunkers, begin to fail. Many other courses in the region have gone through similar renovations recently. Our plan will upgrade the fairways with more drought tolerant grasses, update greens and establish new bunker infrastructure. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that will reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we will be adjusting the internal Clearview entry drive slightly. We will also be re-numbering some holes to improve flow and course play. The Club’s primary goal is improve our sustainability and operate responsibly in the community. In addition, we also strive to be a good neighbor and minimize disruption during construction and with ongoing operations. I’ve included a brief overview below for you. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures will not be part of the project. While the course will be closed to play for the entire modernization process, the clubhouse and pool and fitness center will remain open during the course construction period during 2026 & 2027. EXHIBIT 10Page 629 Golf Course Modernization Activity & Timing In Spring 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While contouring/grading will occur to create a new layout, any earth moving will balance on site so no major import or export of soil is required to complete the project, which will minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass we have selected requires more sunlight to perform than our current shade tolerant turf. The excessive shade produced by our trees today will prevent these new drought tolerant grasses from growing successfully and contributing to our targeted water use reductions. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non-native, failing and/or fire prone eucalyptus and coast redwoods that were planted on site in the 1950’s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic native landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Next Steps Because we share a fence line as neighbors, I would like to schedule time with you personally at your convenience to walk you through the overall plans, the work planned for the hole adjacent to your home and tentative timing of construction activity near you in 2026. We will also be hosting neighbor Open Houses in the coming months to share the plans as well so look for a mailed invitation soon. To keep updated on the latest related to the project, you can also visit our golf course modernization webpage on our club website with information about the project at www.larinconadacc.com. Please let me know your availability to get together and preferred place to meet. I’m happy to host you at the Club or come over to your house. In the interim, if you have any questions or would like additional information, please contact me directly at 408-402-7468 or via email at akimball@larinconadacc.com. Sincerely, Page 630 Andy Kimball, PGA General Manager Page 631 March 7, 2025 Dear Neighbor: Happy Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We now look forward to investing for the next generation. Over the past three years, we have been planning a golf course modernization project to make the course and our operations more environmentally sustainable, responsible, and enjoyable for future generations. While fairway, green, and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early and invite you to a Neighbor Open House so we can share our plans and answer any questions you may have. LA RINCONADA GOLF COURSE MODERNIZATION NEIGHBORHOOD OPEN HOUSE • Date: Thursday, March 20th • Time: 5:30 pm to 7:30 pm (Please stop by at any time as there is no formal presentation) • Location: La Rinconada Country Club 14595 Clearview Drive • Refreshments: Beverages and light appetizers provided • Please RSVP for the Open House via email to: Andy Kimball, PGA General Manager akimball@larinconadacc.com • For more project information please visit our website: www.larinconadacc.com Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course itself has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised, and irrigation and drainage begin to fail. Many other courses in the region have gone through similar renovations recently. (See Reverse Side for more on the 2026 Golf Course Modernization Overview) Page 632 The Club plans upgrade the fairways with more drought tolerant grasses, update greens and establish new bunkers. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that help us reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we plan to adjust the internal entry drive slightly which will improve safety on the drive in. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures is not part of the project. While the golf course will be closed to play for the entire modernization process, the clubhouse, pool and fitness center and driving range will remain open during the course construction period during 2026/2027. Golf Course Modernization Activity & Timing In the spring of 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While some contouring/grading will occur, any earth moving will balance on site so no major import or export of soil is required to complete the project, which minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass requires more sunlight than we currently have on site. Select trees in specific locations will prevent new grasses from growing successfully due to excessive shading. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non- native, failing and/or fire prone eucalyptus and coast redwoods that were planted in the 1950s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Page 633 March 7, 2025 Dear Neighbor: Happy Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We now look forward to investing for the next generation. Over the past three years, we have been planning a golf course modernization project to make the course and our operations more environmentally sustainable, responsible, and enjoyable for future generations. While fairway, green, and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early and invite you to a Neighbor Open House so we can share our plans and answer any questions you may have. LA RINCONADA GOLF COURSE MODERNIZATION NEIGHBORHOOD OPEN HOUSE • Date: Saturday, March 22nd • Time: Noon to 2:00 pm (Please stop by at any time as there is no formal presentation) • Location: La Rinconada Country Club 14595 Clearview Drive • Refreshments: Beverages and light appetizers provided • Please RSVP for the Open House via email to: Andy Kimball, PGA General Manager akimball@larinconadacc.com • For more project information please visit our website: www.larinconadacc.com Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course itself has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised, and irrigation and drainage begin to fail. Many other courses in the region have gone through similar renovations recently. (See Reverse Side for more on the 2026 Golf Course Modernization Overview) Page 634 The Club plans upgrade the fairways with more drought tolerant grasses, update greens and establish new bunkers. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that help us reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we plan to adjust the internal entry drive slightly which will improve safety on the drive in. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures is not part of the project. While the golf course will be closed to play for the entire modernization process, the clubhouse, pool and fitness center and driving range will remain open during the course construction period during 2026/2027. Golf Course Modernization Activity & Timing In the spring of 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While some contouring/grading will occur, any earth moving will balance on site so no major import or export of soil is required to complete the project, which minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass requires more sunlight than we currently have on site. Select trees in specific locations will prevent new grasses from growing successfully due to excessive shading. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non- native, failing and/or fire prone eucalyptus and coast redwoods that were planted in the 1950s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Page 635 March 7, 2025 Dear Neighbor: Happy Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We now look forward to investing for the next generation. Over the past three years, we have been planning a golf course modernization project to make the course and our operations more environmentally sustainable, responsible, and enjoyable for future generations. While fairway, green, and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early and invite you to a Neighbor Open House so we can share our plans and answer any questions you may have. LA RINCONADA GOLF COURSE MODERNIZATION NEIGHBORHOOD OPEN HOUSE • Date: Tuesday, March 25th • Time: 5:30 pm to 7:30 pm (Please stop by at any time as there is no formal presentation) • Location: La Rinconada Country Club 14595 Clearview Drive • Refreshments: Beverages and light appetizers provided • Please RSVP for the Open House via email to: Andy Kimball, PGA General Manager akimball@larinconadacc.com • For more project information please visit our website: www.larinconadacc.com Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course itself has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised, and irrigation and drainage begin to fail. Many other courses in the region have gone through similar renovations recently. (See Reverse Side for more on the 2026 Golf Course Modernization Overview) Page 636 The Club plans upgrade the fairways with more drought tolerant grasses, update greens and establish new bunkers. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that help us reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we plan to adjust the internal entry drive slightly which will improve safety on the drive in. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures is not part of the project. While the golf course will be closed to play for the entire modernization process, the clubhouse, pool and fitness center and driving range will remain open during the course construction period during 2026/2027. Golf Course Modernization Activity & Timing In the spring of 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While some contouring/grading will occur, any earth moving will balance on site so no major import or export of soil is required to complete the project, which minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass requires more sunlight than we currently have on site. Select trees in specific locations will prevent new grasses from growing successfully due to excessive shading. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non- native, failing and/or fire prone eucalyptus and coast redwoods that were planted in the 1950s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Page 637 March 7, 2025 Dear Neighbor: Happy Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We now look forward to investing for the next generation. Over the past three years, we have been planning a golf course modernization project to make the course and our operations more environmentally sustainable, responsible, and enjoyable for future generations. While fairway, green, and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early and invite you to a Neighbor Open House so we can share our plans and answer any questions you may have. LA RINCONADA GOLF COURSE MODERNIZATION NEIGHBORHOOD OPEN HOUSE • Date: Tuesday, April 8th • Time: 5:30 pm to 7:30 pm (Please stop by at any time as there is no formal presentation) • Location: La Rinconada Country Club 14595 Clearview Drive • Refreshments: Beverages and light appetizers provided • Please RSVP for the Open House via email to: Andy Kimball, PGA General Manager akimball@larinconadacc.com • For more project information please visit our website: www.larinconadacc.com Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course itself has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised, and irrigation and drainage begin to fail. Many other courses in the region have gone through similar renovations recently. (See Reverse Side for more on the 2026 Golf Course Modernization Overview) Page 638 The Club plans upgrade the fairways with more drought tolerant grasses, update greens and establish new bunkers. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that help us reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we plan to adjust the internal entry drive slightly which will improve safety on the drive in. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures is not part of the project. While the golf course will be closed to play for the entire modernization process, the clubhouse, pool and fitness center and driving range will remain open during the course construction period during 2026/2027. Golf Course Modernization Activity & Timing In the spring of 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While some contouring/grading will occur, any earth moving will balance on site so no major import or export of soil is required to complete the project, which minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass requires more sunlight than we currently have on site. Select trees in specific locations will prevent new grasses from growing successfully due to excessive shading. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non- native, failing and/or fire prone eucalyptus and coast redwoods that were planted in the 1950s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Page 639 March 7, 2025 Dear Neighbor: Happy Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We now look forward to investing for the next generation. Over the past three years, we have been planning a golf course modernization project to make the course and our operations more environmentally sustainable, responsible, and enjoyable for future generations. While fairway, green, and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early and invite you to a Neighbor Open House so we can share our plans and answer any questions you may have. LA RINCONADA GOLF COURSE MODERNIZATION NEIGHBORHOOD OPEN HOUSE • Date: Thursday, April 10th • Time: 5:30 pm to 7:30 pm (Please stop by at any time as there is no formal presentation) • Location: La Rinconada Country Club 14595 Clearview Drive • Refreshments: Beverages and light appetizers provided • Please RSVP for the Open House via email to: Andy Kimball, PGA General Manager akimball@larinconadacc.com • For more project information please visit our website: www.larinconadacc.com Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course itself has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised, and irrigation and drainage begin to fail. Many other courses in the region have gone through similar renovations recently. (See Reverse Side for more on the 2026 Golf Course Modernization Overview) Page 640 The Club plans upgrade the fairways with more drought tolerant grasses, update greens and establish new bunkers. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that help us reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we plan to adjust the internal entry drive slightly which will improve safety on the drive in. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures is not part of the project. While the golf course will be closed to play for the entire modernization process, the clubhouse, pool and fitness center and driving range will remain open during the course construction period during 2026/2027. Golf Course Modernization Activity & Timing In the spring of 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While some contouring/grading will occur, any earth moving will balance on site so no major import or export of soil is required to complete the project, which minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass requires more sunlight than we currently have on site. Select trees in specific locations will prevent new grasses from growing successfully due to excessive shading. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non- native, failing and/or fire prone eucalyptus and coast redwoods that were planted in the 1950s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Page 641 March 7, 2025 Dear Neighbor: Happy Year! I hope you and your family are well. On behalf of La Rinconada Country Club, I wanted to update you on the status of the Club and our long-term golf course modernization efforts. We are proud of our continued stewardship of one of the largest open spaces in the Town of Los Gatos and enduring support for the larger community as one of its oldest institutions. We now look forward to investing for the next generation. Over the past three years, we have been planning a golf course modernization project to make the course and our operations more environmentally sustainable, responsible, and enjoyable for future generations. While fairway, green, and bunker updates are not anticipated to begin until Spring 2026, we wanted to reach out to you early and invite you to a Neighbor Open House so we can share our plans and answer any questions you may have. LA RINCONADA GOLF COURSE MODERNIZATION NEIGHBORHOOD OPEN HOUSE • Date: Saturday, April 12th • Time: Noon to 2:00 pm (Please stop by at any time as there is no formal presentation) • Location: La Rinconada Country Club 14595 Clearview Drive • Refreshments: Beverages and light appetizers provided • Please RSVP for the Open House via email to: Andy Kimball, PGA General Manager akimball@larinconadacc.com • For more project information please visit our website: www.larinconadacc.com Golf Course Modernization Goals & Overview While clubhouse reconstruction and the pool and fitness center addition were completed in the last twenty years, the golf course itself has not been comprehensively modernized to ensure long term sustainability since the early 1990s. Golf courses typically require major rehabilitation after a 30-year period because fairways grasses become compromised, and irrigation and drainage begin to fail. Many other courses in the region have gone through similar renovations recently. (See Reverse Side for more on the 2026 Golf Course Modernization Overview) Page 642 The Club plans upgrade the fairways with more drought tolerant grasses, update greens and establish new bunkers. We will also be adding native, drought-tolerant and climate responsive trees and installing a more efficient irrigation system that help us reduce our water usage by 30%-40%. Paved cart paths are being scaled back to dramatically reduce the amount of impervious surface on the property and we plan to adjust the internal entry drive slightly which will improve safety on the drive in. No Club Expansion Proposed No changes are proposed for the driving range, clubhouse, pool/fitness center, parking area, or maintenance facility, and no expansion of the course or membership capacity, events, traffic or intensity of the use is planned or proposed as part of this course modernization project. With the exception of a small restroom/comfort station on the interior of the site there will be no building construction so typical construction noise that comes with structures is not part of the project. While the golf course will be closed to play for the entire modernization process, the clubhouse, pool and fitness center and driving range will remain open during the course construction period during 2026/2027. Golf Course Modernization Activity & Timing In the spring of 2026, following approval from the Town, we plan to progress sequentially from hole to hole so only small portions of the property will experience construction activity at any single point in time during the 7-8 month construction period. To minimize disruption for our neighbors, upgrades will last approximately two to four weeks per hole, depending on the hole location. Once complete, there will be a 5-6 month grass grow-in period. While some contouring/grading will occur, any earth moving will balance on site so no major import or export of soil is required to complete the project, which minimize construction traffic. Limited construction equipment will be brought to the site once at the beginning of the project via the Wedgewood gate and remain on site for the duration of the project. Construction materials will be staged on site as well and construction workers will park on site as well during construction, minimizing any potential neighborhood disruption. Drought Tolerant Grasses & Trees The Club currently maintains over 1,100 mature trees across its property. The new drought tolerant turfgrass requires more sunlight than we currently have on site. Select trees in specific locations will prevent new grasses from growing successfully due to excessive shading. In order to achieve our water reduction goals and course layout plan, we need to remove a range of non- native, failing and/or fire prone eucalyptus and coast redwoods that were planted in the 1950s and beyond. We plan tree replacement with new native and drought tolerant trees, mostly Oak trees consistent with the historic landscapes of the area. The net result is that the property will remain with approximately 1,100 trees, similar to the number of trees on site today; however, in more thoughtful locations that will enable a successful transition to the new water saving fairway grasses. Page 643 This Page Intentionally Left Blank Page 644 PROJECT DATA PLANNER/CIVIL ENGINEER:HMH ENGINEERS CONTACT: STEPHAN KUEHN 1570 OAKLAND ROAD SAN JOSE, CA 95131(669)295-2357 DEVELOPMENT TEAM COMFORT STATION ARCHITECT:E2 ARCHITECTS CONTACT: JEFFREY EATON 307 ORCHARD CITY DRIVE, STE 350 CAMPBELL, CA 96008 (408)691-8998 GOLF COURSE ARCHITECT:ORIGINS GOLF DESIGN CONTACT: TODD ECKENRODE 18022 COWAN, STE 230 IRVINE, CA 92614 (949)476-6878LA RINCONADA DRSITE LA RINCONADA DRSITE ARCHITECTURAL AND SITE REVIEW LA RINCONADA COUNTRY CLUB GOLF COURSE MODERNIZATION PROJECT TITLE SHEET OB NOT TO SCALE OB TABLE OF CONTENTS PLANNING/CIVIL ENGINEERING G1.0 TITLE SHEET G2.0 SITE CONTEXT PHOTOGRAPHS G2.1 PRESENT DAY AERIAL G3.0 EXISTING CONDITIONS PLAN G3.1 EXISTING CONDITIONS PLAN G3.2 EXISTING ENTRY ROAD CONDITIONS C-0.0 COVER SHEET C-1.0 CIVIL DRAINAGE & UTILITY PLAN C-1.1 CIVIL DRAINAGE & UTILITY PLAN C-1.2 CIVIL DRAINAGE & UTILITY PLAN C-1.3 CIVIL DRAINAGE & UTILITY PLAN C-1.4 CIVIL DRAINAGE & UTILITY PLAN C-1.5 CIVIL DRAINAGE & UTILITY PLAN C-3.0 CIVIL DETAILS C-3.1 CIVIL DETAILS C-4.0 PRELIMINARY ENTRY ROAD GRADING & DRAINAGE PLAN C-4.1 PRELIMINARY STORMWATER CONTROL PLAN C-5.0 INTERIM EROSION CONTROL MEASURES C-5.1 INTERIM EROSION CONTROL MEASURES C-5.2 INTERIM EROSION CONTROL MEASURES C-6.0 FIRE ACCESS PLAN ARCHITECTURE AO-1 OVERALL PLAN AO-2 DEMOLITION PLAN AO-3 DEMOLITION PLAN AO-4 GRADING PLAN AO-5 GRADING PLAN AO-6 FEATURES PLAN AO-7 FEATURES PLAN AO-8 GRASSING PLAN AO-9 GRASSING PLAN AO-10 EARTHWORKS EXHIBIT AO-11 CART PATH PLAN GOVERNMENT AGENCIES:TOWN OF LOS GATOS CONTACT: RYAN SAFTY 110 E. MAIN STLOS GATOS, CA 95030 (408)354-6802 OWNER:CLEARVIEW GOLF ASSOCIATES LLC CONTACT: ANDY KIMBALL 14595 CLEARVIEW DRIVELOS GATOS, CA 95032 (408)402-7468 ASSESSOR'S PARCEL NUMBER: PROJECT ADDRESS/LOCATION: EXISTING GENERAL PLAN DESIGNATION: EXISTING ZONING DESIGNATION: PROPOSED USE: GROSS SITE AREA: RIGHT-OF-WAY DEDICATION: NET SITE AREA: CONSTRUCTION SCHEDULE:START DATE: COMPLETION DATE: 409-31-001, 409-18-008, -009, -010 17400 WEDGEWOOD AVE AND 17445 ZENA AVE LOS GATOS, CA OPEN SPACE RC- RESOURCE CONSERVATION, R-1:20 SINGLE FAMILY RESIDENTIAL GOLF COURSE ±118.35 AC ±000.00 AC ±118.35 AC 3/16/2026 9/28/2026 PROJECT DESCRIPTION DEVELOPER:LA RINCONADA COUNTRY CLUB CONTACT: ANDY KIMBALL 14595 CLEARVIEW DRIVE LOS GATOS, CA 95032 (408)402-7468 ARCHITECTURAL AND SITE REVIEW FOR GOLF COURSE RENOVATIONS AND UPGRADES TO THE EXISTING GOLF COURSE INCLUDING A NEW CONNECTING CART PATH, NEW TEE, FAIRWAY, GREEN, AND BUNKER AREAS, TURF REPLACEMENT TO INCREASE DROUGHT TOLERANCE, A REALIGNED ENTRY ROAD, AND UPDATES TO THE EXISTING COMFORT STATION. PROJECT INCLUDES TREE REMOVAL AND REPLACEMENT. AO-12 IRRIGATION MAINLINE PLAN AO-13 CONSTRUCTION DETAILS AO-14 CONSTRUCTION DETAILS PA0.0 GENERAL INFORMATION (COMFORT STATION) PA0.3 BLUEPRINT FOR A CLEAN BAY PA1.0 OVERALL AND ENLARGED PROPOSED SITE PLAN PA2.3 PROPOSED FLOOR PLAN PA2.4 PROPOSED DIMENSIONED FLOOR PLAN & WALL TYPES PA2.6 PROPOSED ROOF PLAN PA3.1 PROPOSED EXTERIOR ELEVATIONS PA4.1 PROPOSED FF&E FLOOR PLAN & ELEVATIONS PA6.1 PROPOSED REFLECTED CEILING PLAN LANDSCAPE COVER COVER SHEET TP-1 TREE PROTECTION & REMOVAL PLAN TP-2 TREE PROTECTION & REMOVAL PLAN TP-3 TREE PROTECTION & REMOVAL PLAN TP-4 TREE PROTECTION & REMOVAL PLAN TP-5 TREE PROTECTION & REMOVAL PLAN TP-6 TREE PROTECTION & REMOVAL PLAN TI-1 TREE INVENTORY TI-2 TREE INVENTORY T1-3 TREE INVENTORY T1-4 TREE INVENTORY TI-5 TREE INVENTORY TI-6 TREE INVENTORY TI-7 TREE INVENTORY TI-8 TREE INVENTORY TI-9 TREE INVENTORY TI-10 TREE INVENTORY TI-11 TREE INVENTORY IP-1 IRRIGATION PLAN IP-2 IRRIGATION PLAN IP-3 IRRIGATION PLAN IP-4 IRRIGATION PLAN IP-5 IRRIGATION PLAN IP-6 IRRIGATION PLAN PP-1 PLANTING PLAN PP-2 PLANTING PLAN PP-3 PLANTING PLAN PP-4 PLANTING PLAN PP-5 PLANTING PLAN PD-1 PLANTING DETAILS PD-2 PLANTING TYPICALS LK0.1 LAKE SYSTEM SITE PLAN, NOTES, ETC LK1.1 LAKE SYSTEM PLAN VIEW LK1.2 LAKE SYSTEM PLAN VIEW LK1.3 LAKE SYSTEM PLAN VIEW LK1.4 LAKE SYSTEM PLAN VIEW LK1.5 LAKE SYSTEM PLAN VIEW LK2.1 LAKE SYSTEM CROSS SECTIONS LK3.1 LAKE SYSTEM DETAILS LK3.2 LAKE SYSTEM DETAILS LK3.3 LAKE SYSTEM DETAILS LK3.4 LAKE SYSTEM DETAILS LK3.5 LAKE SYSTEM DETAILS LK3.6 LAKE SYSTEM DETAILS LK4.1 LAKE AERATION SYSTEM DETAILS LK4.2 LAKE AERATION SYSTEM DETAILS LK5.1 LAKE TRANSFER PUMP STATION LK6.1 LAKE SYSTEM MECHANICAL DETAILS DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504TS.DWG454504TS.DWG G1.0 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/2/2025 8:02 AMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility Design Land Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS WE D G E W O O D A V E WE D G E W O O D A V E HW Y 8 5 HW Y 8 5 CLEARVIEW DRCLEARVIEW DR WIMBLEDON DRWIMBLEDON DRWINCHESTER BLVDWINCHESTER BLVDGRANADA WAYGRANADA WAYLANDSCAPE ARCHITECT:PINNACLE DESIGN CONTACT: KEN ALPERSTEIN 77935 CALLE TAMPICO, STE 220 LA QUINTA, CA 92253 (760)636-2558 CIVIL ENGINEER: CLIFF BECHTEL AND ASSOCIATES, LLC CONTACT: CLIFF BECHTEL 1321 254TH PLACE, SE SAMMAMISH, WA 98075 (650)333-0103 OB 9292 EXHIBIT 11Page 645 SITE CONTEXT PHOTOGRAPHS NOT TO SCALE DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504SITE_PHOTOS.DWG454504SITE_PHOTOS.DWG G2.0 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:52 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS 9292 Page 646 PRESENT DAY AERIAL NOT TO SCALE DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504PRESENT DAY AERIAL.DWG454504PRESENT DAY AERIAL.DWG G2.1 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/2/2025 7:48 AMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility Design Land Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS 9292 Page 647 275 280 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280 285 290 295 300 305 310 315 320 325 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 350 350 355 360 365 370 375 380 350 350 350 355 360 365 370 370 365375 375 380 380 380 380 380 380 375 370365355 330 325 330 335 340 345 350 355 360 365 370 280 285 280 290 295 300 305 310 315 320 285 290 295 300 305 310 285290 295 300305 310 315 320 325 330 335 280 280 275 27 5 28 0 380375370365360355350350345335325 340 345 350 355 345 34033536069 67 270 270 27 5 28 0MULBERRYDRIVELORADRIVE LA RINCONADADRIVELA RINCONADADRIVEEASTVIEWDRIVECLEARVIEWDRIVECLEARVIEW DRIVE G R A N A D A W A Y WEDGEWOOD AVEN U E WEDGEWOOD AVENUECAPI S T R A N O PLAC E NALORCOURTWIMBLEDON DR WEDGEWOOD AVEN U E AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40.26' PUBLIC STREET EASEMENT AREA NOT PART OF PROJECT SITE LA RINCONADA DRWEDGEWOOD DR EXISTING CONDITIONS PLAN OB AS SHOWN OB VICINITY MAP SCALE: 1" = 1000' DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EX.DWG454504EX.DWG G3.0 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:53 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS SK 1 INCH = 150 FEET 0 75 150 300 LINETYPE LEGEND EXISTING PROPERTY LINE PROJECT BOUNDARY CENTERLINE CONTOURS EXISTING EASEMENT EXISTING TOPOGRAPHY 9292 Page 648 365 370 375 380 375 380 385 345 350 355 350 350 355 360 365 370 375380 350 350 350 355 360 365 370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370370365365355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400 400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330 350 355 360 365 370 305 310 380375370365360355350350345 350 355 345 34033536069 67 EASTVIEWDRIVEZENA AVENUE EATON LANEKARLAVENUELA RINCONADA DRIVEKARL AVENUEVIA DELSUROF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 10' SEWER EASEMENT 40' ROAD EASEMENT EXISTING CONDITIONS PLAN OB AS SHOWN OB DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EX.DWG454504EX.DWG G3.1 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:54 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS SK 1 INCH = 150 FEET 0 75 150 300 LINETYPE LEGEND EXISTING PROPERTY LINE PROJECT BOUNDARY CENTERLINE CONTOURS EXISTING EASEMENT EXISTING TOPOGRAPHY 9292 Page 649 SITE LA RINCONADA DRWEDGEWOOD DR 345 350 355 350 305 310 345 350 355 AC 351.66 AC 351.64 AC 351.15 AC 350.90 AC 350.14 AC 349.64 AC 348.36 AC 349.69 AC 348.57 AC 347.80 AC 346.96 AC 346.79 AC 347.19 AC 350.62 AC 349.46 AC 351.88 AC 352.84 AC 353.03 AC 354.94 AC 354.93 1.1% 1.8%1.1%3.0% 2.7% AC 346.43 ~ LP 19 .3 ' ± EX ROAD26.2'± EX ROAD23.4'± EX ROAD 1.0 % 2.2 %3.8%2 . 2% 1.7 % 8.0 %9.5%3.2%3.4%4.6%0.5% EX 8 " V C P ~ 1 9 1 'EX 8" VCP ~ 258'EX 8" V C P ~ 4 3 8' EX SSMH RIM 348.5±EX 8" INV 338.4± EX SSMH RIM 357.6±EX 8" INV 348.6± EX SSMHRIM 350.3± EX 8" INV 336.3± EX GREASE INTERCEPTOR EX 8" VCP ~ 137'20 ' ± E X E N T R Y G A T E EX LIGHT POLE, TYP.EX 12" SDEX OUTFALL. 1 0 ' P S S E CLEARVIEW DRIVE(PUBLIC STREET) WATERVALVEBOX WATERVALVEVAULT COMMBOX ELECBOX ELECBOX ELECBOX ELECBOX ELECBOX EX 8 " S S EX 8"S SEX 12"SD275 280 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280285 290 295 300 305 310 315 320 325 285 290 295 300 305 310 315 320 325 330 335340 345 350 355 350 350 355 360 365 370 375380 350 350 350355 360 365 370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370 370 365 365 355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330 325 330 335 340 345 350 355 360 365 370 280 285 280 290 295 300 305 310 315 320 285 290 295 300 305 310 285290295 300305310 315 320 325 330 335 280 280 275 275 280 380375 370 365 360 355 350 350345335325 340 345 350 355 345340335 360 69 67 270 270 275 280 AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40.26' PUBLIC STREET EASEMENT 40' ROAD EASEMENT AREA NOT PARTOF PROJECT EXISTING ENTRY ROAD CONDITIONS OB AS SHOWN OB VICINITY MAP SCALE: 1" = 1000' DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EX.DWG454504EX.DWG G3.2 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:54 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS SK 1 INCH = 20 FEET 4020100 ABBREVIATIONS LEGEND PROPERTY LINE PROJECT BOUNDARY EX FACE OF CURB EX AC SPOT GRADES AC XX.XX AC ASPHALT CONCRETEEX/(E) EXISTING LP LOW POINTPSSE PUBLIC SANITARY SEWER EASEMENTSD STORM DRAIN SDFI STORM DRAIN FIELD INLETSS SANITARY SEWER SSMH SANITARY SEWER MANHOLE SSCO SANITARY SEWER CLEANOUT X%X%EX PERCENT & DIRECTION OF SURFACE FLOWDRAINAGE EX SSMH EX SSCO EX SANITARY SEWER PIPE EX SS PIPE SLOPE EX STORM DRAIN PIPE DIA" MATERIAL ~ LENGTH' EX SDFI EX ELECTROLIER EX FIRE HYDRANT EX BACKFLOW PREVENTER KEYMAP SCALE: 1" = 1000' ENTRY ROAD AREA OF WORK 9292 Page 650 SDSD1 1 . 9% 5.5%2.0%2.0%6.3% 1 2 . 4% 3.0% 2.9 % 3.6 % SDFIRIM 346.912" INV 342.4 OUT CONFORM TO EX AC 356.8± CONFORM TO EX AC 356.0± CONFORM TO EX AC 352.3± E X 1 0 ' P U B L I C SAN I T AR Y S EW ER E A S EM EN T EX PORTION OF ENTRY ROAD TO BE REMOVED EX PL CONFORM TO EX AC 352.0± TC 347.3FL 346.8 TC 347.0~LPFL 346.5 TC 350.5~GBFL 350.0 TC 350.1~GBFL 349.7 TC 350.1~GB FL 349.6 BIORETENTION AREA TOP OF SLOPE = 347.0TOP OF SOIL = 346.4 LIMIT OF WORK PROJECT BOUNDARY TC 350.5~GBFL 350.0 22' NEWENTRY ROADSD OUTFALL12" INV 341.7 EX ENTRY ROAD 12" PVC @ S=1%AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40.26' PUBLIC STREET EASEMENT 40' ROAD EASEMENT AREA NOT PARTOF PROJECT PRELIMINARY ENTRY ROAD GRADING & DRAINAGE PLAN CM/TU AS SHOWN CM/TU DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504GP.DWG454504GP.DWG C4.0 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:55 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS 1 INCH = 20 FEET 4020100 1. GRADES, INVERTS, AND UTILITY LOCATIONS SHOWN ON THIS PLAN ARE CONCEPTUAL ONLY AND ARE NOT TO BE USED FOR CONSTRUCTION. NOTES ABBREVIATIONS LEGEND PROPOSED EXISTING PROPERTY LINE STORM DRAIN PIPE SD PROJECT BOUNDARY EASEMENT GRADE BREAK SPOT GRADES FG XX.XX EG XX.XX AC ASPHALT CONCRETE EX/(E) EXISTINGEG EXISTING GRADE FG FINISH GRADE FL FLOW LINEFS FINISH SURFACE GB GRADE BREAKHP HIGH POINTINV INVERT LP LOW POINT PL PROPERTY LINESD STORM DRAIN SDFI STORM DRAIN FIELD INLETTC TOP OF CURB STORM DRAIN FIELD INLET X%X%PERCENT & DIRECTION OF SURFACE FLOW DRAINAGE BIORETENTION BASIN STORM DRAIN PERFORATED PIPE OUTFALL SD KEYMAP SCALE: 1" = 1000' ENTRY ROAD AREA OF WORK 2:1 MAX SLOPE AC PAVEMENT RESPONSIBILITY TO INDEPENDENTLY ESTIMATE APPROXIMATE. IT SHALL BE THE CONTRACTOR'S NOTE: EARTHWORK QUANTITIES SHOWN ARE EARTHWORK QUANTITIES FILL:CUT: EXPORT:IMPORT: QUANTITIES FOR HIS/HER OWN USE. 480 CY 0 CY 480 CY 0 CY 92 Page 651 275 280 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280 285 290 295 300 305 310 315 320 325 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 350 350 355 360 365 370 375380 350 350 350 355 360 365 370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370 370 365 365 355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400 400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330 325 330 335 340 345 350 355 360 365 370 280 285 280 290 295 300 305 310 315 320 285 290 295 300 305 310 285290 295 300305 310 315 320 325 330 335 280 280 275 275 28 0 380375370365360355350350345335325 340 345 350 355 345 340335 36069 67 270 270 27 5 28 0 111810171615141312126543789AREA NOT PARTOF PROJECT AREA NOT PART OF PROJECT AREA NOT PARTOF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40.26' PUBLIC STREET EASEMENT 40' ROAD EASEMENT AREA NOT PART OF PROJECT TCM 2 BIORETENTION AREA 616 SF REQUIRED621 SF PROVIDED DMA1 DMA2 UT-1 UT-2 UT-3 UT-4 PAVEM E N T SLOP E T O DRAIN18" MIN.6" HIGH CURB 6" HIG H CURB SECTION VIEW 16" A A A-A SEE BIORETENTION OR FTP DETAILS CURB OPENING2 N.T.S. WARPED GUTTER CL PLAN VIEW 3'-6"12" A A 1'-6" MIN 6" VARIES SEE PLAN 0.2'MIN.6"6"X"3 MAX PLACE 4" MIN. DIA. APPROVEDCOBBLE 0.2' BELOW CURBOPENINGS FOR DISTANCE OF 2' EITHER SIDE OF CURB OPENINGS DEPRESS 2" AT OPENING 24"24" FLOWS T O BIORETE N T I O N A R E A 1 SIZING METHODS: 4% 12" MIN. OF CLASS II PERMEABLE ROCK PER CALTRANS SPECS. ROCK SECTION TO INCREASE WITH SLOPE OF PIPE. VARIES VARIES PERFORATED PIPE(SLOPE AT 0.50% MIN) W/ PERFORATIONS DOWN. SEE PLAN FOR LENGTH AND LOCATION. 3:1 MA X 18"CLEANOUT W/ CAP AT FINISH GRADE VARIES-SEE PLAN VARIES-SEE PLAN PLACE 4" MIN. DIA. APPROVED COBBLE 0.2' BELOW CURB OPENINGS FORDISTANCE OF 2' EITHER SIDE OF CURB OPENINGS. PLACE GEOTEXTILE BETWEEN COBBLES & NATIVE SOIL FOR EROSION CONTROL. SOLID OVERFLOW PIPE BIORETENTION BASIN W/ LINER N.T.S. CHRISTY V12 OR APPROVED EQUAL OVERFLOW RISER W/ GRATE BIO-TREATMENTSOIL MIX (BSM)PER APPENDIX C OF THE SCVURPPP C.3 STORMWATER HANDBOOK. RISER HEIGHT SEE TCM SUMMARY TABLE 0.2" 8" MIN. ALL PLANTS WITHIN BIORETENTION BASIN TO BE SELECTED PER APPENDIX D OF THE SCVURPPP C.3 STORMWATER HANDBOOK IMPERMEABLE LINER PRELIMINARY STORMWATER CONTROL PLAN CM/TU AS SHOWN CM/TU DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504SW.DWG454504SW.DWG C4.1 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/2/2025 8:14 AMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility Design Land Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS 1 INCH = 250 FEET 0 125 250 500 DMA#LID TREATMENT DRAINAGE AREA STORM DRAIN PIPE SD SD SD CATCH BASIN STORM DRAIN MANHOLE CATCH BASIN (EXISTING) CURB INLET (EXISTING) STORM DRAIN MANHOLE (EXISTING) PROJECT BOUNDARY LEGEND BIORETENTION AREA PROJECT SITE INFORMATION: 1. SOILS TYPE: CLAY LOAM 2. GROUND WATER DEPTH: 30 TO 50 FT 3. NAME OF RECEIVING BODY: SAN TOMAS AQUINO CREEK 4. FLOOD ZONE: ZONE X 5. FLOOD ELEVATION (IF APPLICABLE): N/A OPERATION AND MAINTENANCEINFORMATION: I. PROPERTY INFORMATION: I.A. PROPERTY ADDRESS: 14595 Clearview Drive Los Gatos, CA 95032 APN: 409-31-001 409-18-008, -009, -010 I.B. PROPERTY OWNER: La Rinconada Country Club II. RESPONSIBLE PARTY FOR MAINTENANCE: II.A. CONTACT: La Rinconada Country Club II.B. PHONE NUMBER OF CONTACT: (408) 402-7468 II.C. EMAIL: akimball@Larinconadacc.com II.D. ADDRESS: 14595 Clearview Drive Los Gatos, CA 95032 1. DISPOSITION AND TREATMENT OF STORM WATER WILL COMPLY WITH THE NATIONAL POLLUTION DISCHARGE ELIMINATION SYSTEM STANDARDS AND IMPLEMENTATION STANDARDS ESTABLISHED BY THE SANTA CLARA VALLEY URBAN RUNOFF POLLUTION PREVENTION PROGRAM. NOTES SOURCE CONTROL MEASURES: 1. MAINTENANCE (PAVEMENT SWEEPING, CATCH BASIN CLEANING, GOOD HOUSEKEEPING). 2. STORM DRAIN LABELING. SITE DESIGN MEASURES: 1. MINIMIZE IMPERVIOUS SURFACES 2. OTHER SELF-TREATING AREA (E.G. LANDSCAPED AREAS) 3. SELF-RETAINING AREA 1. SEE GRADING PLAN FOR BASIN FOOTPRINT AND DESIGN ELEVATIONS. 2. PLACE 3 INCHES OF COMPOSTED, NON-FLOATABLE MULCH INAREAS BETWEEN STORMWATER PLANTINGS AND SIDE SLOPE. 3. SEE LANDSCAPE PLAN FOR MULCH, PLANT MATERIALS AND IRRIGATION REQUIREMENTS 4. CURB CUTS SHALL BE A MINIMUM 18" WIDE AND SPACED AT MAXIMUM 10' O.C. INTERVALS AND SLOPED TO DIRECT STORMWATER TO DRAIN INTO THE BASIN. CURB CUTS SHALL ALSO NOT BE PLACED INLINE WITH OVERFLOW CATCH BASIN.SEE GRADING PLAN FOR MORE DETAIL ON LOCATIONS OFCURB CUTS. 5. A MINIMUM 0.2' DROP BETWEEN STORM WATER ENTRY POINT (I.E. CURB OPENING, FLUSH CURB, ETC.) AND ADJACENT LANDSCAPE FINISHED GRADE. 6. DO NOT COMPACT NATIVE SOIL / SUBGRADE AT BOTTOM OF BASIN. LOOSEN SOIL TO 12" DEPTH. BIORETENTION & FLOW-THROUGH PLANTER NOTES: AS THE GOLF COURSE IS MOSTLY PERVIOUS, PROPOSED CART PATHS WILLDRAIN TO LANDSCAPE AREAS AND BE CONSIDERED "SELF-RETAINING" AREAS. THE PROPOSED DRIVEWAY RECONFIGURATION WILL BE TREATED BY A BIORETENTION PLANTER THAT IS SIZED TO TREAT NEW AND EXISTINGPORTIONS OF THE ENTRY ROAD. STORMWATER TREATMENT SUMMARY 9292 Page 652 275 280 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 360 365 370 375 380 375 380 385 280 285 290 295 300 305 310 315 320 325 285 290 295 300 305 310 315 320 325 330 335 340 345 350 355 350 350 355 360 365 370 375 380 350 350 350 355 360 365 370 370 365375 380 380 380 380 330 325 330 335 340 345 350 355 360 365 370 280 285 280 290 295 300 305 310 315 320 285 290 295 300 305 310 285290 295 300305 310 315 320 325 330 335 280 280 275 27 5 28 0 380375370365360355350350345335325 340 345 350 355 345 34033569 67 270 270 27 5 28 0 111810126543789AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40.26' PUBLIC STREET EASEMENT AREA NOT PART OF PROJECT EX 12"SDSTABILIZED CONSTRUCTION ENTRANCE TC-1 C5.2 FIBER ROLLS (TYP.) STORM DRAIN INLET PROTECTION SE-1 C5.2 FIBER ROLLS (TYP.)SE-5 C5.2 SE-5 C5.2 CLEARVIEW DRIVECLEARVIEW DRIVE LA RINCONADA DRIVEWE D G E W O O D A V E GRANADA WAY APPROXIMATE CONSTRUCTION STAGING AREAS DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EC.DWG454504EC.DWG C5.0 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:56 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS INTERIM EROSION CONTROL MEASURES TU AS SHOWN TU 1 INCH = 150 FEET 0 75 150 300 GENERAL EROSION AND SEDIMENT CONTROL NOTES 1. CONTRACTOR/OWNER: CLIFF BECHTEL AND ASSOCIATES, LLC ADDRESS: 1321 254TH PLACE, SE SAMMAMISH, WA 98075 ATTN: CLIFF BECHTEL (650) 333-0103 IT SHALL BE THE OWNER'S RESPONSIBILITY TO MAINTAIN CONTROL OF THE ENTIRE CONSTRUCTION OPERATION AND TO KEEP THE ENTIRE SITE IN COMPLIANCE WITH THE SOIL EROSION CONTROL PLAN. 2. CIVIL ENGINEER: HMH ENGINEERS 1570 OAKLAND ROAD, SUITE 200 SAN JOSE, CA 95131 ATTN: STEPHAN KUEHN (408) 487-2200 3. THIS PLAN IS INTENDED TO BE USED FOR INTERIM EROSION AND SEDIMENT CONTROL ONLY AND IS NOT TO BE USED FOR FINAL ELEVATIONS OR PERMANENT IMPROVEMENTS. 4. DEVELOPER WILL SUBMIT TO THE CITY MONTHLY (AT THE FIRST OF EACH MONTH BETWEEN OCT 1ST AND APRIL 30TH) CERTIFICATIONS THAT ALL EROSION/SEDIMENT MEASURES IDENTIFIED ON THE APPROVED EROSION CONTROL PLAN ARE IN PLACE. IF MEASURES ARE NOT IN PLACE, DEVELOPER SHALL PROVIDE THE CITY WITH A WRITTEN EXPLANATION OF WHY THE MEASURE IS NOT IN PLACE AND WHAT WILL BE DONE TO REMEDY THIS SITUATION. 5. OWNER/CONTRACTOR SHALL BE RESPONSIBLE FOR MONITORING EROSION AND SEDIMENT CONTROL MEASURES PRIOR, DURING, AND AFTER STORM EVENTS. 6. REASONABLE CARE SHALL BE TAKEN WHEN HAULING ANY EARTH, SAND, GRAVEL, STONE, DEBRIS, PAPER OR ANY OTHER SUBSTANCE OVER ANY PUBLIC STREET, ALLEY OR OTHER PUBLIC PLACE. SHOULD ANY BLOW, SPILL, OR TRACK OVER AND UPON SAID PUBLIC OR ADJACENT PRIVATE PROPERTY, IMMEDIATE REMEDY SHALL OCCUR. 7. SANITARY FACILITIES SHALL BE MAINTAINED ON THE SITE. 8. DURING THE RAINY SEASON, ALL PAVED AREAS SHALL BE KEPT CLEAR OF EARTH MATERIAL AND DEBRIS. THE SITE SHALL BE MAINTAINED SO AS TO MINIMIZE SEDIMENT LADEN RUNOFF TO ANY STORM DRAINAGE SYSTEM, INCLUDING EXISTING DRAINAGE SWALES AND WATER COURSES. 11. CONSTRUCTION OPERATIONS SHALL BE CARRIED OUT IN SUCH A MANNER THAT EROSION AND WATER POLLUTION WILL BE MINIMIZED. STATE AND LOCAL LAWS CONCERNING POLLUTION ABATEMENT SHALL BE COMPLIED WITH. 12. CONTRACTOR SHALL PROVIDE DUST CONTROL AS REQUIRED BY THE APPROPRIATE FEDERAL, STATE AND LOCAL AGENCY REQUIREMENTS. LEGEND FIELD INLET SEDIMENT BARRIER FIBER ROLL STABILIZED CONSTRUCTION ENTRANCE SEE SHEET C5.1 EXISTING CONTOUR TO REMAIN PROPOSED CONTOUR 9292 Page 653 365 370 375 380 375 380 385 345 350 355 350 350 355 360 365 370 375 380 350 350 350 355 360 365 370 370 365375 375 375 375 380 380 380 380 380 380 375 375 375 370370365365355 360 380 380 380385 385 385 390 390 390 395 395 395 400 400 400 400 400 395 395 395 395 370 370 370 370 365 365 365 365 360 360 360 360 355 355 355 350 345 330 350 355 360 365 370 305 310 380375370365360355350350345 350 355 345 34033536069 6711 181017161514131289OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 10' SEWER EASEMENT 40' ROAD EASEMENT C5.2 FIBER ROLLS (TYP.)SE-5 C5.2LA RINCONADA DRIVEZENA WAY LA RINCONADA DRIVE APPROXIMATE CONSTRUCTION STAGING AREAS DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EC.DWG454504EC.DWG C5.1 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:56 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS INTERIM EROSION CONTROL MEASURES TU AS SHOWN TU 1 INCH = 150 FEET 0 75 150 300 LEGEND FIELD INLET SEDIMENT BARRIER FIBER ROLL STABILIZED CONSTRUCTION ENTRANCE SEE SHEET C5.0 EXISTING CONTOUR TO REMAIN PROPOSED CONTOUR 9292 Page 654 DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504EC.DWG454504EC.DWG C5.2 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:56 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS INTERIM EROSION CONTROL MEASURES TU AS SHOWN TU N.T.S. ENCROACHMENT DETAIL N.T.S. FIBER ROLL INSTALLATION 3/4" x 3/4" WOOD STAKES MAX4" SPACING 4" MAX 12" MIN 2" MIN FIBER ROLL 8" MIN 4' MAX 4' MAX 4' MAX 4' MAX VERTICAL SPACING MEASURED ALONGTHE FACE OF THE SLOPE VARIESBETWEEN 10' AND 20' NOTE:INSTALL FIBER ROLL ALONG A LEVELCONTOUR FIBER ROLLS INSTALL FIBER ROLL NEAR SLOPE WHERE IT TRANSITIONS INTO A STEEPER SLOPE NOTE:SIZE SPILLWAY TO CONVEY PEAKDESIGN FLOW TYPICAL OPEN SPILLWAY EARTH EMBANKMENT OUTLET PROTECTION EXCAVATE IF NECESSARY FORSTORAGE OUTLET PIPE OR USE ALTERNATIVEOPEN SPILLWAY FLOW WATERTIGHT CONNECTION PERFORATE RISER ALL SLOPE 1:3 (V:H) OR FLATTER 12" MIN 5'-0" MIN TYPICAL SLOPE SOIL STABILIZATION N.T.S. SE-5 FIBER ROLLSN.T.S. SE-3 SEDIMENT TRAP -12" MIN. UNLESS OTHERWISE SPECIFIED BY SOILS ENGINEER CORRUGATED STEEL PANELS FILTER FABRIC ORIGINAL GRADE CRUSHED AGGREGATE GREATER THAT 3" BUT SMALLER THAN 6" SECTION A-A FILTER FABRIC ORIGINAL GRADE CRUSHED AGGREGATE GREATER THAT 3" BUTSMALLER THAN 6" -12" MIN. UNLESSOTHERWISE SPECIFIED BY SOILS ENGINEER SECTION B-B N.T.S. N.T.S. NOTE:MANY DESIGNS CAN BE FIELD FABRICATED, ORFABRICATED UNITS MAY BE USED TC-3 ENTRANCE / OUTLET TIRE WASH N.T.S. PAVED R O A D W A Y MATCH EXISTING GRADE WASH ROCK B A A B WATER SUPPLY &HOSE CRUSHED AGGREGATE GREATER THAT 3" BUTSMALLER THAN 6" 50' MIN. OR FOUR TIMES THE CIRCUMFERENCEOF THE LARGEST CONSTRUCTIONVEHICLE TIRE, WHICHEVER ISGREATER 10' MIN OR AS REQUIRED TOACCOMMODATEANTICIPATEDTRAFFIC, WHICHEVER B B SECTION B-B EXISTING PAVED ROADWAYDITCHFILTER FABRIC -12" MIN. UNLESS OTHERWISE SPECIFIEDBY SOILS ENGINEER R=20' MIN.ORIGINAL GRADE TC-1 STABILIZED CONSTRUCTION ENTRANCE/EXIT N.T.S. N.T.S. MATCH EXISTING GRADE IS GREATER. 24' MIN. NOTE:CONSTRUCT SEDIMENT BARRIERAND CHANNELIZE RUNOFF TOSEDIMENT TRAPPING DEVICE -12" MIN. UNLESS OTHERWISE SPECIFIEDBY SOILS ENGINEER CORRUGATED STEEL PANELS FILTER FABRIC ORIGINAL GRADE CRUSHED AGGREGATE GREATER THAT 3" BUT SMALLER THAN 6" SECTION A-A N.T.S. CORRUGATED STEEL PANELS SEDIMENT TRAPPINGDEVICE AA SE-10 STORM DRAIN INLET PROTECTION - TYPE 1 N.T.S. NOTES: 1. FOR USE IN AREAS WHERE GRADING HAS BEEN COMPLETED AND FINAL SOIL STABILIZATION AND SEEDING ARE PENDING SHAPE BASIN SO THAT LONGEST INFLOW AREA FACES LONGEST LENGTH OFTRAP 2. NOT APPLICABLE IN PAVED AREAS 3. NOT APPLICABLE WITH CONCENTRATED FLOWS SHEET FLOWLESS THAN 1 ACRE SHEET F L O W SHE E T F L O W 6' MIN OVERLAP AT ENDS OF SILT FENCE A A GEOTEXTILE BLANKET SILT FENCE PER SE-01 PLAN SECTION A-A DRAIN INLET GEOTEXTILE BLANKET 24" +/- SE-10 STORM DRAIN INLET PROTECTION - TYPE 2 N.T.S. NOTES: 1. FOR USE IN CLEARED AND GRUBBED AND IN GRADED AREAS 2. SHAPE BASIN SO THAT LONGEST INFLOW AREA FACES LONGEST LENGTH OF TRAP 3. FOR CONCENTRATED FLOWS SHAPE BASIN IN 2:1 RATIO WITH LENGTH ORIENTED TOWARDS DIRECTION FLOW EDGE OF SEDIMENT TRAP A A DRAIN INLET GEOTEXTILE BLANKET SILT FENCE PER SE-01 ROCK FILTER (USE IF FLOW ISCONCENTRATED) SHEET FLOW SHEET F L O W SHE E T F L O W PLAN 12"-24" MAX 4' STABILIZE AREA AND GRADE UNIFORMLY AROUND PERIMETER SECTION A-ANOTE:REMOVE SEDIMENT BEFOREREACHING ONE-THIRD FULL 1:1 SLOPE 1:1 SLOPE 9292 Page 655 RED CURB W/ WHITE LETTERING "FIRE LANE"EVERY 30' (TYP) EX ENTRY ROAD 54' RELOCATED PRIVATE FIRE HYDRANTFROMTO1 2 . 4% 6.3%22' NEWENTRY ROADR = 52' EX MECHANICAL ENTRY GATE WITH KNOX SWITCH AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT AREA NOT PARTOF PROJECT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40.26' PUBLIC STREET EASEMENT 40' ROAD EASEMENT AREA NOT PARTOF PROJECT 12.4% 6.3%22' NEWENTRY ROAD EX HYDRANT TOREMAIN (587± LF)RELOCATEDHYDRANT (627± LF) EX HYDRANT TO BERELOCATED (591± LF) FURTHEST POOLSTRUCTURE HYDRANT TRAVELDISTANCE CONT135C-ROAD-CURB-FACE-E C-DRIV-CNTR-E 142 CL1 C-ROAD-LIPG-E 142 CONT FACE OF CURB EXISTINGLIP OF GUTTER EXISTING C-DRIV-E 142 CONT DRIVEWAY CENTERLINE EXISTINGDRIVEWAY EXISTING EXISTING SURFACE IMPROVEMENT LAYOUTLAYER NAME COLOR LINETYPE SAMPLE DESCRIPTION C-SWLK-E 135 CONT SIDEWALK EXISTINGC-SWLK-WCHR-E 142 CONT WHEELCHAIR RAMP EXISTINGC-ROAD-MONU-E CONTWHITE MONUMENT EXISTING DRIVEWAY EXISTING C-STRM-SWAL-CONC-E WHITE SWALE JDITCH OR CONCRETE SWALE EXISTING8SWALEJDITCH OR CONCRETE SWALE DEMOLISHC-STRM-SWAL-CONC-D C-PRKG-STRP-E 127 CONT PARKING STRIPING EXISTING C-ROAD-VALL-GUTT-E 142 CONT VALLEY GUTTER EXISTINGC-ROAD-STRP-E 127 CONT ROAD STRIPING EXISTING C-SITE-SIGN-E CONTWHITE SIGN EXISTING C-DRIV-D 8 SHORT DRIVEWAY DEMOLISHC-DRIV-CNTR-D 8 CL1 DRIVEWAY CENTERLINE DEMOLISHC-PRKG-STRP-D 8 SHORT PARKING STRIPING DEMOLISHSHORT8C-ROAD-CURB-FACE-D FACE OF CURB DEMOLISHC-ROAD-LIPG-D 8 SHORT LIP OF GUTTER DEMOLISHC-ROAD-STRP-D 8 SHORT ROAD STRIPING DEMOLISHC-ROAD-VALL-GUTT-D 8 SHORT VALLEY GUTTER DEMOLISH C-SWLK-D 8 SHORT SIDEWALK DEMOLISHC-SWLK-WCHR-D 8 SHORT WHEELCHAIR RAMP DEMOLISH C-TREE-E CONT8 TREE EXISTING COMMENTS ALWAYS DRAW TO SCALE WITH THIS LAYER COMBOALWAYS DRAW TO SCALE WITH THIS LAYER COMBO SEE SAMPLE BELOW ON HOW TO DRAFTSEE SAMPLE BELOW ON HOW TO DRAFT SEE SAMPLE BELOW ON HOW TO DRAFTSEE SAMPLE BELOW ON HOW TO DRAFT ADA RAMP EXISTING C-TREE-SANJ-E CONT8 STREET TREE EXISTING MUST USE FOR CITY OF SAN JOSE PUBLIC IP ONLY, IF LA DRAFTS IT MUST APPEAR LIKE THIS FOR PW APPROVALC-TREE-D SHORT8 TREE DEMOLISH C-TREE-SANJ-D SHORT8 STREET TREE DEMOLISH MUST USE FOR CITY OF SAN JOSE PUBLIC IP ONLY, IF LA DRAFTS IT MUST APPEAR LIKE THIS FOR PW APPROVAL PLEASE NOTE NEW BLOCK WITH GRIPS TO ADJUST DIAMETER AND DRIPLINE C-SITE-FENC-E 62 FENCE EXISTING SITE FENCE C-TREE-WELL-E CONT8 STREET TREE WELL EXISTING EX HYDRANT TO REMAIN (587± LF)RELOCATEDHYDRANT (627± LF) EX HYDRANT TO BE RELOCATED (591± LF) FURTHEST POOL STRUCTURE HYDRANT TRAVELDISTANCE FIRE ACCESS PLAN CM/TU AS SHOWN CM/TU DRAWN BY: PROJECT NO: CAD DWG FILE: CHECKED BY: DESIGNED BY: DATE: SCALE: HMHC DATE DESCRIPTIONNOLA RINCONADA COUNTRY CLUBGOLF COURSE MODERNIZATION PROJECT17400 WEDGEWOOD AVE AND 17445 ZENA AVEARCHITECTURAL AND SITE REVIEWS-25-005S:\PROJECTS\454500\PL\454504 GOLF COURSE\PL\PERMIT- ARCHITECTURAL AND SITE REVIEW\454504FA.DWG454504FA.DWG C6.0 4545.04 JANUARY 17, 2025 80 PLOTTED: 7/1/2025 3:57 PMOF Land Use EntitlementsLand PlanningLandscape ArchitectureCivil EngineeringUtility DesignLand Surveying Stormwater Compliance 1570 Oakland Road (408) 487-2200San Jose, CA 95131 HMHca.com 1 3/28/2025 PER TOWN COMMENTS 2 5/23/2025 PER TOWN COMMENTS 3 7/01/2025 PER TOWN COMMENTS 1 INCH = 20 FEET 4020100 KEYMAP SCALE: 1" = 1000' ENTRY ROAD AREA OF WORK STRIPING NOTES: 1. ALL STRIPING, MARKINGS AND SIGNING INSTALLATION TO BE PERFORMED BY THE CONTRACTOR. (EXCEPT AS NOTED) 2. UNLESS INDICATED OTHERWISE, ALL SIGN TYPES SHOWN ON THIS PLAN ARE PER THE 2014 CALIFORNIA MUTCD. 3. ALL TEMPORARY STRIPING AND PAVEMENT MARKINGS MUST BE REINSTALLED BACK TO ORIGINAL CONFIGURATION UPON PROJECT COMPLETION. FIRE ACCESS NOTES: 1. PRIVATE FIRE HYDRANT TO BE RELOCATED. SEE BELOW FOR LOCATION. PRIVATE FIRE HYDRANT IS A DEFERRAL SUBMITTAL ITEM. 2. PRELIMINARY STREET SECTION FOR ENTRY ROAD IS 3" AC ON 6" AB AND WILL SUPPORT 75,000 LBS. FINAL STREET PAVEMENT DESIGN SHALL BE BASED ON A GEOTECHNICAL REPORT. 3. GATE ALONG ENTRY ROAD IS MANUALLY OPERATED AND SHALL BE SECURED BY A KNOX APPROVED PADLOCK. HYDRANT TRAVEL DISTANCE SCALE: 1" = 60' 9292 Page 656 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 657 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 658 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 659 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 660 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 661 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 662 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 663 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 664 REV. 03/28/25REV. 05/23/25REV. 07/01/2501/17/25Page 665 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40' ROAD EASEMENT SHEETS A0-3, AO-5, AO-7, AO-9 SHEETS A0-2, AO-4, AO-6, AO-8 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 7 8 9 Sheet: AO-1 Scale: 1" = 150' Date: rev 1: 3/28/25 Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:North0 75 150 300 450 OVERALL PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com LTS .667 1/17/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 666 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 10' SEWER EASEMENT 40' ROAD EASEMENT 11 18 10 17 16 15 14 13 12 8 9 350 355 360 365370375380375380385 335 340345 350 355350350 355 360 365 37 0 375 380 3503 5 0 350 3 5 5 3 6 0 3 6 5 3 7 0 370 365375375 375 375380 380 380 380 380 375375375370 370365365 355360380 380 380 3 8 5 385 385 390 39039 0 395 395 395 400 4004 00 4 0 0 400 395 395 395 395 370 370 370 3 7 0 365365365 3 6 5 36 0360 360 3 6 0 355 355 35 5 35034 5 330 345350355360365370 300305 310 380 375 370 365 36035535035 0 34 5 33 5 3 2 5 34034 53 5 0 355345340 33 5 360 380 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:NorthDEMOLITION PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com REMOVE 7,183 S.F. OF CONCRETE CART PATH 1" = 100' 0 50 100 200 300 UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. REMOVE 9,068 S.F. OF CONCRETE CART PATH REMOVE 7,928 S.F. OF CONCRETE CART PATH REMOVE 10,551 S.F. OF CONCRETE CART PATH REMOVE 9,919 S.F. OF CONCRETE CART PATH REMOVE 10,317 S.F. OF CONCRETE CART PATH REMOVE 9,386 S.F. OF CONCRETE CART PATH REMOVE 2,317 S.F. OF CONCRETE CART PATH REMOVE 2,846 S.F. OF CONCRETE CART PATH REMOVE 2,859 S.F. OF CONCRETE CART PATH REMOVE 2,119 S.F. OF ASPHALT CART PATH REMOVE 2,676 S.F. OF ASPHALT CART PATH REMOVE 1,285 S.F. OF ASPHALT CART PATH AO-2SEE SHEET A0-3LIMITS OF DISTURBANCE (TYP) EXISTING 5' CONTOUR (TYP) EXISTING 1' CONTOUR (TYP) 1/17/25 LEGEND LIMITS OF DISTURBANCE PROPOSED CONCRETE CART PATH TO BE REMOVED WORK AREA PROPOSED ASPHALT CART PATH TO BE REMOVED EXISTING CART PATH NOTES SEE SHEET AO-11 FOR ADDITIONAL CART PATH INFORMATION. TREE TO BE REMOVED EXISTING TREE CANOPY rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 667 AREA NOT PART AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 11 18 10 1 2 6 5 4 3 7 8 9 275280285290295300305 310 315 320 325 330 335 340 345 350 355 360 365370375380375380385 2 8 0285290295300305310315320 3252 8 5 290 295 300 305 310 315 320 325 330335 340345 350 355350350355 360 365 3 7 0 375 380 3503 5 0 3503 5 5 3 6 0 3 6 5 3 7 0 370 365375375 380 380 380 380 380 375370 365 355330 325 330 335 340 345350355360365370 280285280290295300305 310315320 285290295 300305310 285290295300305310315320325330335280280275275280380 375 370 365 36035535035 0 34 5 33 5 325 34034 5 3 5 0 355345340 33 5 360 270275280380 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:NorthDEMOLITION PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com 1" = 100' 0 50 100 200 300 UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. REMOVE 2,577 S.F. OF CONCRETE CART PATH REMOVE 4,531 S.F. OF ASPHALT CART PATH REMOVE 12,290 S.F. OF CONCRETE CART PATH REMOVE 7,264 S.F. OF CONCRETE CART PATH REMOVE 11,090 S.F. OF CONCRETE CART PATH REMOVE 2,279 S.F. OF CONCRETE CART PATH REMOVE 3,114 S.F. OF CONCRETE CART PATH REMOVE 4,130 S.F. OF CONCRETE CART PATH REMOVE 7,422 S.F. OF CONCRETE CART PATH AO-3SEE SHEET A0-2LIMITS OF DISTURBANCE (TYP) EXISTING 5' CONTOUR (TYP) EXISTING 1' CONTOUR (TYP) 1/17/25 NOTES SEE SHEET AO-11 FOR ADDITIONAL CART PATH INFORMATION. LEGEND LIMITS OF DISTURBANCE PROPOSED CONCRETE CART PATH TO BE REMOVED WORK AREA PROPOSED ASPHALT CART PATH TO BE REMOVED EXISTING CART PATH TREE TO BE REMOVED EXISTING TREE CANOPY rev 1: 3/26/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 668 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 10' SEWER EASEMENT 40' ROAD EASEMENT 11 18 10 17 16 15 14 13 12 8 9 381 395 3933 9 0 385 36 1 36 2 37 0371 37 0 375 365 360 365 360 3 5 5 357 361 365 370 380375385380375370 348 347349 395 390 385 365 360 372 373 378 375 370 365 375 376 377 366 365361368367 373 381 378377382 380 38 5 3 8 9 375370 350 355 360 365370375380375380385 335 340345 350 355350350 355 360 365 37 0 375 380 3503 5 0 350 3 5 5 3 6 0 3 6 5 3 7 0 370 365375375 375 375380 380 380 380 380 375375375370 370365365 355360380 380 380 3 8 5 385 385 390 39039 0 395 395 395 400 4004 00 4 0 0 400 395 395 395 395 370 370 370 3 7 0 365365365 3 6 5 36 0360 360 3 6 0 355 355 35 5 35034 5 330 345350355360365370 300305 310 380 375 370 365 36035535035 0 34 5 33 5 3 2 5 34034 53 5 0 355345340 33 5 360 380 36611 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:NorthGRADING PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com 1" = 100' 0 50 100 200 300 AO-4 UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE.SEE SHEET A0-3LEGEND TURF CONVERSION TO NATIVE PLANT MATERIAL PROPOSED GOLF FEATURE - BUNKER PROPOSED GOLF FEATURE - TEE PROPOSED GOLF FEATURE - GREEN PROPOSED GOLF FEATURE - FAIRWAY GRASS PROPOSED GOLF FEATURE - ROUGH GRASS TURF CONVERSION TO MULCH 1/17/25 TURF CONVERSION TO NATIVE GRASS rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 669 AREA NOT PART AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 11 18 10 1 2 6 5 4 3 7 8 9 300 305 380 348 347349 336 335 343 335 33 8 33 0 325 320 315 31 3 3 1 2 3 1 0 3 0 5 300 295 295 310315 3 1 0 305 300290 285 281 2 9 3 295 290 292 292 290 285 2802 8 0 287 286 285 304 305 378 375 370 375 376 377 366 365361368367 373 381 378377382 380 38 5 3 8 9 375370 275280285290295300305 310 315 320 325 330 335 340 345 350 355 360 365370375380375380385 2 8 0285290295300305310315320 3252 8 5 290 295 300 305 310 315 320 325 330335 340345 350 355350350355 360 365 3 7 0 375 380 3503 5 0 3503 5 5 3 6 0 3 6 5 3 7 0 370 365375375 380 380 380 380 380 375370 365 355330 325 330 335 340 345350355360365370 280285280290295300305 310315320 285290295 300305310 285290295300305310315320325330335280280275275280380 375 370 365 36035535035 0 34 5 33 5 325 34034 5 3 5 0 355345340 33 5 360 270275280380 295 3 1 5 3 3 0 36611 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:NorthGRADING PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com 1" = 100' 0 50 100 200 300 La RINCONADA GOLF COURSEMODERNIZATION PROJECTAO-5SEE SHEET A0-21/17/25 LEGEND TURF CONVERSION TO NATIVE PLANT MATERIAL PROPOSED GOLF FEATURE - BUNKER PROPOSED GOLF FEATURE - TEE PROPOSED GOLF FEATURE - GREEN PROPOSED GOLF FEATURE - FAIRWAY GRASS PROPOSED GOLF FEATURE - ROUGH GRASS TURF CONVERSION TO MULCH TURF CONVERSION TO NATIVE GRASS UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. rev 1: 3/28/25 rev 2: 5/23/25 rev 3: 7/1/25 Page 670 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 10' SEWER EASEMENT 40' ROAD EASEMENT 11 18 10 17 16 15 14 13 12 8 9 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: 1" = 100' Date: Notes: Prepared For: Designed By:FEATURES PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change.North0 50 100 200 300 NEW TEE (TYP.) NEW CART PATH CONCRETE (TYP.) 10' WIDE (ORANGE DASHED LINE) NEW/REBUILT BUNKER (TYP.) TURF REDUCTION ZONE (TYP.) SEE PLANS BY PINNACLE DESIGN CO. NEW GREEN (TYP.) NEW CART PATH CONCRETE (TYP.) 8' WIDE (BLACK DASHED LINE) NEW FAIRWAY (TYP.) REALIGNED ENTRY ROAD PLANS BY OTHERS PUTTING GREEN LAKE REBUILD SEE PLANS BY OTHERS. LAKE REBUILD & EXPAND SEE PLANS BY OTHERS. MEADOW ZONE (TYP.) AO-6 UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE.SEE SHEET A0-31/17/25 LEGEND TURF CONVERSION TO NATIVE PLANT MATERIAL PROPOSED GOLF FEATURE - BUNKER PROPOSED GOLF FEATURE - TEE PROPOSED GOLF FEATURE - GREEN PROPOSED GOLF FEATURE - FAIRWAY GRASS PROPOSED GOLF FEATURE - ROUGH GRASS TURF CONVERSION TO MULCH TURF CONVERSION TO NATIVE GRASS NEW CART PATH CONCRETE WIDTH VARIES rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 671 AREA NOT PART AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 11 18 10 1 2 6 5 4 3 7 8 9 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: 1" = 100' Date: Notes: Prepared For: Designed By:FEATURES PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change.North0 50 100 200 300 NEW TEE (TYP.) NEW CART PATH CONCRETE (TYP.) 10' WIDE (ORANGE DASHED LINE) NEW/REBUILT BUNKER (TYP.) TURF REDUCTION ZONE (TYP.) SEE PLANS BY PINNACLE DESIGN CO. NEW GREEN (TYP.) NEW CART PATH CONCRETE (TYP.) 8' WIDE (BLACK DASHED LINE) NEW FAIRWAY (TYP.) REALIGNED ENTRY ROAD PLANS BY OTHERS PUTTING GREEN LAKE REBUILD & EXPAND SEE PLANS BY OTHERS. MEADOW ZONE (TYP.) AO-7SEE SHEET A0-21/17/25 LEGEND TURF CONVERSION TO NATIVE PLANT MATERIAL PROPOSED GOLF FEATURE - BUNKER PROPOSED GOLF FEATURE - TEE PROPOSED GOLF FEATURE - GREEN PROPOSED GOLF FEATURE - FAIRWAY GRASS PROPOSED GOLF FEATURE - ROUGH GRASS TURF CONVERSION TO MULCH TURF CONVERSION TO NATIVE GRASS UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 672 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 10' SEWER EASEMENT 40' ROAD EASEMENT 11 18 10 17 16 15 14 13 12 8 9 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:NorthGRASSING PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com GREENS - SEED BENTGRASS (TYP.) ROUGHS - SEED RYEGRASS (TYP.) FAIRWAYS - SOD BERMUDAGRASS (TYP.) TEES - SOD BERMUDAGRASS (TYP.) 1" = 100' 0 50 100 200 300 BUNKER LIPS - SOD FESCUE (TYP.) MEADOW ZONES - HYDROSEED FESCUE (TYP.) AO-8 UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE.SEE SHEET A0-31/17/25 LEGEND TURF CONVERSION TO NATIVE PLANT MATERIAL PROPOSED GOLF FEATURE - BUNKER PROPOSED GOLF FEATURE - TEE PROPOSED GOLF FEATURE - GREEN PROPOSED GOLF FEATURE - FAIRWAY GRASS PROPOSED GOLF FEATURE - ROUGH GRASS TURF CONVERSION TO MULCH TURF CONVERSION TO NATIVE GRASS rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 673 AREA NOT PART AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 11 18 10 1 2 6 5 4 3 7 8 9 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 78 9 Sheet: Scale: Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:NorthGRASSING PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com GREENS - SEED BENTGRASS (TYP.) ROUGHS - SEED RYEGRASS (TYP.) 1" = 100' 0 50 100 200 300 BUNKER LIPS - SOD FESCUE (TYP.) FAIRWAYS - SOD BERMUDAGRASS (TYP.) TEES - SOD BERMUDAGRASS (TYP.) MEADOW ZONES - HYDROSEED FESCUE (TYP.) AO-9SEE SHEET A0-21/17/25 LEGEND TURF CONVERSION TO NATIVE PLANT MATERIAL PROPOSED GOLF FEATURE - BUNKER PROPOSED GOLF FEATURE - TEE PROPOSED GOLF FEATURE - GREEN PROPOSED GOLF FEATURE - FAIRWAY GRASS PROPOSED GOLF FEATURE - ROUGH GRASS TURF CONVERSION TO MULCH TURF CONVERSION TO NATIVE GRASS UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 674 Sheet: Scale: nts Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:EARTHWORKS EXHIBIT18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com EARTHWORK PLAN STATEMENT THE EARTHWORK QUANTITIES AND COLOR CODED CUT & FILL AREAS SHOWN ON THIS PLAN ARE BASED ON THE EXISTING AND PROPOSED CONTOURING SHOWN ON THE PERMIT DRAWINGS. THIS INFORMATION SHALL BE USED BY THE GOLF COURSE CONTRACTOR TO PLAN THE GRADING OPERATIONS AND OVERALL EXCAVATION & FILL REQUIREMENTS FOR THE PROJECT TO ACHIEVE A BALANCED EARTHWORK OPERATION. THE GOLF COURSE CONTRACTOR SHALL USE THE INFROMATION SHOWN ON THIS SHEET TO ADJUST THE SHOWN PROPOSED CONTOURING, APPROXIMATELY 3 TO 6 INCHES, TO ACHIEVE A BALANCED EARTHWORK OPERATION OF APPROXIMATELY 52,300 CUBIC YARDS CUT AND 52,300 CUBIC YARDS FILL. NO OFF HAUL OR IMPORT OF NATIVE SOIL IS ANTICIPATED FOR THE PROJECT SCOPE. AO-10 1/17/25 rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 675 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40' ROAD EASEMENT 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 7 8 9 Sheet: Scale: 1" = 150' Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:North0 75 150 300 450 CART PATH PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com LTS .667 LEGEND CART PATH REMOVED - CONCRETE CART PATH REMAINS. WIDTHS & MATERIALS VARY. QUANTITIES 123,071 S.F.TOTAL CART PATH REMOVED 103,130 S.F.TOTAL CART PATH INSTALLED AO-11 1/17/25 NEW CONCRETE CART PATH 8' WIDE NEW CONCRETE CART PATH 10' WIDE CART PATH REMOVED - ASPHALT CART PATH TO REMAIN 12' WIDE ASPHALT CART PATH TO REMAIN 8' WIDE CONCRETE CART PATH TO REMAIN 20' WIDE ASPHALT UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 676 AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT AREA NOT PART OF PROJECT 40.26' PUBLIC STREET EASEMENT 60' SCVWD EASEMENT 10' SEWER EASEMENT 40' ROAD EASEMENT 11 18 10 17 16 15 14 13 12 1 2 6 5 4 3 7 8 9 Sheet: Scale: 1" = 150' Date: Notes: Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. Prepared For: Designed By:North0 75 150 300 450 IRRIGATION MAINLINE PLAN18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com LTS .667 AO-12 1/17/25 8" IRRIGATION MAINLINE UTILITY NOTE ALL UTILITIES SHOWN ARE APPROXIMATE AND BASED ON FILES RECEIVED FROM CLUB. DESIGNER DOES NOT REPRESENT THESE ARE ACCURATE OR COMPLETE. rev 1: 3/28/25 6" IRRIGATION MAINLINE 10" IRRIGATION MAINLINE IRRIGATION LAKE FILL LINE FROM WELL LEGEND 6" IRRIGATION MAINLINE IRRIGATION LAKE FILL LINE FROM WELL 10" IRRIGATION MAINLINE 8" IRRIGATION MAINLINE La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 677 TYPICAL TEE SECTION TYPICAL DRAINAGE SYSTEM TEES AND BUNKERS TYPICAL BUNKER DRAINAGE ALL DRAIN PIPE INSIDE OF BUNKER SHALL BE 4" PERFORATED N12 OR EQUIVALENT. ALL DRAIN PIPE OUTSIDE OF BUNKER SHALL BE SOLID N12 CPEP OR EQUIVALENT. TRENCHES SHALL BE 6" WIDE AND 8" DEEP. LINE ALL TRENCHES WITH GRAVEL BEFORE INSTALLING PERFORATED PIPE. BACKFILLED TRENCH TO BE FLUSH WITH SUB-GRADE.777 6 7 5 7 4 73 76 74 73 77 76 7578 73 75 76 74 TYPICAL CATCH BASIN ROUGH GRADING TYPICAL CATCH BASIN SEED BED PREP Sheet: Scale: NTS Date: Notes: Prepared For: Designed By:CONSTRUCTION DETAILSTYPICAL BUNKER SECTION DIRECTION OF PLAY 18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com 4" CPEP OUTFALL GRAVEL FILLED TRENCHES WITH 4" PERFORATED N12 4" SOLID CPEP TURN UP AND CAP FOR FLUSHOUT MARK WITH 2 WRAPS OF TRACE WIRE 4" PERFORATED CPEP N12 OR EQUIVALENT 4" WYE 4" END CAP SOD FOR TYPE AND PLANTING METHOD SEE SPECIFICATIONS SOD TEE SURROUNDS 3:1 SLOPE MAXIMUM COMPACTED SUB-GRADE FINISHED GRADE 1% SLOPE LASER VERIFIED FOR TYPE AND DEPTH OF TEE MIX SEE SPECIFICATION SOD BUNKER COMPLEX COMPACTED SUB-GRADE DEPTH OF TOPSOIL @ LIP CAN VARY DUE TO DESIRED IRREGULAR LIP HEIGHT (TO BE DETERMINED IN FIELD) 6" LOOSE SAND AT INSTALLATION (4" COMPACTED) 2% MIN SLOPE AT BOTTOM OF SUB-GRADE TO DRAIN LINE BACKFILL TRENCH WITH GRAVEL 4" PERFORATED CPEP N12 OR EQUIVALENT TOPSOIL EXTEND RISER 2'-4' ABOVE GRADE BACKFILL WITH APPROVED GRAVEL COMPACTED SUB-GRADE DOUBLE WALL CPEP (SIZE VARIES) 12" END CAP AND/OR SET RISER IN CONCRETE TO SEAL PILE GRAVEL AROUND RISER UNTIL READY FOR GRASSING 12" PERFORATED N12 OR EQUIVALENT TO A MIN. DEPTH OF 2' 12" NON-PERFORATED N12 OR EQUIVALENT DRILL HOLE TO MATCH PIPE SIZE. SEAL WITH 'GREAT STUFF' EXPANDING FOAM OR EQUIVALENT REMOVE EXCESS GRAVEL, FINISH GRADE TO DRAIN, CUT RISER AND INSTALL CAST IRON GRATE. SOD "2 RINGS" WIDE AROUND ALL BASINS COMPACTED SUB-GRADE SUB GRADE SLOPE 1% TO MATCH SLOPE OF TEE TOP SEE SPECIFICATIONS FOR BUNKER LINER DETAILS. Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. AO-13 1/17/25 rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 Page 678 6"15.0' MAX 8"TYPICAL DRAINAGE LAYOUT TYPICAL FINISHED GREEN TYPICAL GREEN CAVITY12-16"12"4"TYPICAL CLEAN-OUT DETAIL TYPICAL GREEN DRAIN CONNECTION Sheet: Scale: NTS Date: Notes: Prepared For: Designed By:CONSTRUCTION DETAILS18022 Cowan, Suite 200 Irvine,California 92614 USA p:(949) 476-6878 f:(949) 476-6875 www.originsgolfdesign.com TYPICAL DRY SUMP PLACE IN OUT OF PLAY AREAS WHEN POSSIBLE 6'-0"6'-0"4" CARRY OFF DRAINAGE FROM GOLF FEATURE COMPACTED SUB-GRADE SOD "2 RINGS" WIDE AROUND BASIN 12" DIAMETER CAST IRON GRATE SET ON TOP OF PIPE 2" NATIVE SOIL OVER GRAVEL 12" PERFORATED RISER BACKFILL WITH APPROVED GRAVEL 12" END CAP DRILL HOLE TO MATCH PIPE SIZE SEAL WITH 'GREAT STUFF' EXPANDING FOAM OR EQUILAVENT FINISHED GRADE COMPACTED SUB-GRADE FINISHED GRADE COMPACTED SUB-GRADE DRAINAGE TRENCH COMPACTED SUB-GRADE 4" GRAVEL BLANKET 4" PERFORATED DRAIN PIPE N-12 OR EQUAL GREENS MIX COMPACTED TO 12" GREENS MIX 30 MIL PVC GREEN LINER FINISHED GRADE CAP AT FINISHED GRADE WITH TORO 850-00 VALVE COVER OR EQUAL 4" SOLID CPEP DOUBLE WALL 4" 45° 4" SOLID CPEP DOUBLE WALLCOMPACTED SUB-GRADE 4" GRAVEL BLANKET GRAVEL FILLED TRENCH 4" PERFORATED CPEP N-12 OR EQUAL FINISHED GRADE GREENS MIX 30 MIL PVC GREEN LINER 4" GRAVEL BLANKET GRAVEL FILLED TRENCH 4" PERFORATED CPEP N-12 OR EQUAL 4" 45° COMPACTED SUB-GRADE 4" WYE 4" ELBOW 4" SOLID CPEP DOUBLE WALL CARRY-OFF LINE 4" TEE FOR "SMILE" DRAIN Copyright 2025. Todd Eckenrode - Origins Golf Design expressly reserves the common law and statutory copyright and other property rights in these plans. These plans are not to be used, reproduced, changed or copied in any form or manner whatsoever, nor may they be assigned to any third party, without first obtaining the express, written consent and permission of Todd Eckenrode - Origins Golf Design. These drawings as prepared by the Golf Course Architect are the Instruments of Service for use solely with respect to this project. The Golf Course Architect shall be deemed the authors and owners of their respective Instruments of Service and shall retain all common law, statutory and other reserved rights, including copyrights. No other right to use Instruments of Service shall be deemed granted or implied. The Owner, his partners, heirs, successors or assigns shall not use the Instruments of Service unless the Owner obtains the prior written Agreement of the Golf Course Architect to do so specifically. Any unauthorized use of the Instrument of Service shall be at the Owner's sole risk. The Golf Course Architect shall not be liable for, or responsible for any such un-approved use or change. AO-14 rev 1: 3/28/25La RINCONADA GOLF COURSEMODERNIZATION PROJECTrev 2: 5/23/25 rev 3: 7/1/25 1/17/25 Page 679 EARTH / COMPACTED FILL XY-# 1 A 1/ A101 1 A101 CONCRETE SAND / MORTAR ALUMINUM STEEL FINISH WOOD ROUGH WOOD / CONTINUOUS WOOD BLOCK METAL STUD PLYWOOD BATT INSULATION RIGID INSULATION GYPSUM WALL BOARD SPOT ELEVATIONX' - XX" MATCH LINE CONTROL POINT / DATUM REVISION TAG / CLOUD1 KEY NOTE TAG# FINISH TAG WINDOW TAG1i DOOR TAG EXTERIOR ELEVATION NUMBER SHEET NUMBER DETAIL NUMBER SHEET NUMBER A101 1 1 A101 BUILDING SECTION NUMBER SHEET NUMBER 1 A101 WALL SECTION NUMBER SHEET NUMBER INTERIOR ELEVATION NUMBER SHEET NUMBER ROOM NAME ROOM NUMBER Room name 101 DIMENSION TO FACE OF STRUCTURE DIMENSION TO CENTERLINE DIMENSION TO FACE OF FINISH PROPERTY LINE COLUMN REFERENCE GRIDS CLEARVIEW DR WI MBLEDON DRWINCHESTER BLVDHWY 17H WY 280 AREA OF WORK IFPC ISSUED FOR PLAN CHECK IFRS ISSUED FOR RESUBMITTAL □SUBMITTED WITHOUT REVISION ■SUBMITTED WITH REVISION NOT SUBMITTED / REMOVED FROM SET ABBREVIATIONS SYMBOL LEGEND & AND (E) EXISTING (N) NEW (P) PROPOSED @ AT A/C AIR CONDITIONING AC ASPHALTIC CONCRETE ACOUST ACOUSTICAL ADJ ADJUSTABLE AFF ABOVE FINISH FLOOR ALT ALTERNATE ALUM ALUMINUM APPROX APPROXIMATE ARCH ARCHITECT / ARCHITECTURAL B.O. BOTTOM OF B/W BETWEEN BD BOARD BKG BACKING BLDG BUILDING BLKG BLOCKING BOT BOTTOM CAB CABINET CEM CEMENT CJ CONSTRUCTION JOINT / CONTROL JOINT CL CENTER LINE CLG CEILING CLO CLOSET CLR CLEAR CMU CONCRETE MASONRY UNIT CO CLEAN OUT COL COLUMN CONC CONCRETE CONN CONNECTION CONSTR CONSTRUCTION CONT CONTINUOUS CPT CARPET CT CERAMIC TILE CTR CENTER DBL DOUBLE DEPT DEPARTMENT DF DRINKING FOUNTAIN DIA DIAMETER DIM DIMENSION DN DOWN DS DOWNSPOUT DSP DRY STAND PIPE DTL DETAIL DWG DRAWING EA EACH EL ELEVATION ELEC ELECTRICAL ELEV ELEVATOR EMER EMERGENCY ENCL ENCLOSURE EQ EQUAL EQUIP EQUIPMENT ES EACH SIDE EW EACH WAY EXT EXTERIOR FD FLOOR DRAIN FDN FOUNDATION FE FIRE EXTINGUISHER FEC FIRE EXTINGUISHER CABINET FF FINISH FLOOR FIN FINISH FL FLOOR FOC FACE OF CONCRETE FOF FACE OF FINISH FR FRAME FRP FIBERGLASS REINFORCED PANEL FSD FIRE SEPERATION DISTANCE FT FOOT OR FEET FTG FOOTING FURR FURRING GA GAUGE GALV GALVANIZED GL GLASS GR GRADE GSM GALVANIZED SHEET MTL. GYP GYPSUM HB HOSE BIBB HDWR HARDWARE HM HOLLOW METAL HORIZ HORIZONTAL HR HOUR HT HEIGHT HVAC HEATING, VENTILATING & AIR CONDITIONING IFHPC ISSUE FOR HEALTH PLAN CHECK IFPC ISSUE FOR PLAN CHECK IFPPC ISSUE FOR PLANNING PLAN CHECK IN INCH OR INCHES INCL INCLUDE INSUL INSULATION INT INTERIOR INV INVERT CLIENT:LA RINCONADA COUNTRY CLUB 14595 CLEARVIEW DR LOS GATOS, CA 95032 ANDY KIMBALL E: akimball@larinconadacc.com ARCHITECT:E2 ARCHITECTURE 307 ORCHARD CITY DRIVE, STE. 350 CAMPBELL, CA 95008 JEFFREY EATON, AIA P: (408) 691-8998 E: jeffrey@e2astudio.com VICINITY MAP SHEET NUMBER SHEET NAME IFPC_S1GENERAL INFORMATION PA0.0 GENERAL INFORMATION PA0.3 BLUEPRINT FOR A CLEAN BAY ARCHITECTURAL PA1.0 OVERALL & ENLARGED PROPOSED SITE PLAN PA2.3 PROPOSED FLOOR PLAN PA2.4 PROPOSED DIMENSIONED FLOOR PLAN & WALL TYPES PA2.6 PROPOSED ROOF PLAN PA3.1 PROPOSED EXTERIOR ELEVATIONS PA4.1 PROPOSED FF&E FLOOR PLAN & ELEVATIONS PA6.1 PROPOSED REFLECTED CEILING PLAN JAN JANITOR JT JOINT LAB LABORATORY LAM LAMINATE LAV LAVATORY LB POUND LF LINEAR FEET LG LARGE LT LIGHT M.R. MOISTURE RESISTANT MAT MATERIAL MAX MAXIMUM MECH MECHANICAL MEMB MEMBRANE MEZZ MEZZANINE MFR MANUFACTURER MIN MINIMUM MISC MISCELLANEOUS MTD MOUNTED MTL METAL MUL MULLION N.I.C. NOT IN CONTRACT NO. NUMBER NOM NOMINAL NS NO SCALE NTS NOT TO SCALE O/ OVER O/A OVERALL OC ON CENTER OCC OCCUPANCY OFD OVERFLOW DRAIN OH OPPOSITE HAND OPNG OPENING OPOI OWNER PROVIDED, OWNER INSTALLED P.LAM. PLASTIC LAMINATE PIP POURED IN PLACE PKG PARKING PL PLATE PLAS PLASTER PLYWD PLYWOOD PT POINT RAD RADIUS RD ROOF DRAIN REF REFERENCE REFR REFRIGERATOR REINF REINFORCED REQ REQUIRED RM ROOM RO ROUGH OPENING RWL RAINWATER LEADER SAN SANITARY SC SOLID CORE SCD SEE CIVIL DRAWINGS SCHED SCHEDULE SEC SECTION SED SEE ELECTRICAL DRAWINGS SHT SHEET SHWR SHOWER SIM SIMILAR SLD SEE LANDSCAPE DRAWINGS SMD SEE MECHANICAL DRAWINGS SOG SLAB ON GRADE SPD SEE PLUMBING DRAWINGS SPEC SPECIFICATION SQ SQUARE SS STAINLESS STEEL SSD SEE STRUCTURAL DRWAINGS STD STANDARD STL STEEL STOR STORAGE STRUCT STRUCTURAL SUSP SUSPENDED SV SHEET VINYL SWR SEWER SYM SYMMETRICAL SYS SYSTEM T & B TOP & BOTTOM T & G TONGUE & GROOVE T.O. TOP OF TBD TO BE DETERMINED TEL TELEPHONE TEMP TEMPORARY THK THICK TV TELEVISION TYP TYPICAL U.O.N. UNLESS OTHERWISE NOTED UNF UNFINISHED VCT VINYL COMPOSITION TILE VERT VERTICAL VEST VESTIBULE VIF VERIFY IN FIELD W WIDE W/ WITH W/O WITHOUT WC WATER CLOSET WD WOOD WDW WINDOW WG WIRE GLASS WH WATER HEATER WP WATERPROOF WR WATER RESISTANT WSP WET STAND PIPE WT WEIGHT YD YARD Ø DIAMETER TOWN OF LOS GATOS MUNICIPAL CODE 2022 CBC, CPC, CMC, CEC 2022 CALIFORNIA FIRE CODE (WITH LOCAL AMENDMENTS) 2022 BUILDING ENERGY EFFICIENCY STANDARDS 2022 CALIFORNIA GREEN BUILDING STANDARDS OCCUPANCY: TYPE OF CONSTRUCTION: APN: ZONING: BUILDING AREA: SITE AREA: SPRINKLERED: B ll-B 63.71 ACRE / 2,775,207 SF 445 SF RC -RESOURCE CONSERVATION 40931001 NO ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:43:35 PMPA0.0 GENERAL INFORMATIONLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE LA RINCONADA COMFORT STATION 17400 WEDGEWOOD AVE AND 17445 ZENA AVE, LOS GATOS, CA 95032 PREVAILING CODES SHEET INDEX LEGEND SHEET INDEX LEGEND SCOPE OF WORK GENERAL INFORMATION APPROVAL STAMP PROJECT DIRECTORY Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/25CONSTRUCTION OF NEW RESTROOMS AT EXISTING SITE. SCOPE OF WORK INCLUDES CONSTRUCTION OF NEW WALLS, FINISHES, LIGHTING, ROOF, AND ASSOCIATED PLUMBING FIXTURES FOR RESTROOM ACCOMMODATIONS. CIVIL ENGINEER: CLIFF BECHTEL AND ASSOCIATES, LLC 1321 254TH PLACE, SE SAMMAMISH, WA 98075 CLIFF BECHTEL P: (650)333-0103 PLANNER:HMH ENGINEERS 1570 OAKLAND ROAD SAN JOSE, CA 95131 STEPHAN KUEHN P: (669)295-2357 Page 680 ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:43:57 PMPA0.3 BLUEPRINT FOR A CLEAN BAYLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 Author CheckerRev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/25Page 681 PROPERTY LINE PL XX.XX'LENGTH OF PROPERTY LINE EXISTING PARKING LOT ROAD GOLF-CART ROAD EXISTING BUILDING NOT IN SCOPE PL1026.96' PL 70 1.2 6'PL297.16'PL 3 3 9 .6 6 ' PL 2 3 5 .6 8 'PL 907.50' PL 946.44' PL 791.34' PL 191.04' PL 868.56' PL 907.50' PA1.0 2 AREA OF WORK 257' - 0" ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:43:58 PMPA1.0 OVERALL & ENLARGED PROPOSED SITE PLANLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE KEYNOTES LEGEND PLAN NORTH TRUE NORTH 1" = 160'-0"1OVERALL PROPOSED SITE PLAN Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/251" = 10'-0"2ENLARGED PROPOSED SITE PLAN Page 682 PA3.1 3 PA3.1 1 BAR 100101 102 100 PA3.1 4 PA3.1 2 1 12/ PA4.13/ PA4.14/ PA4.1 5/ PA4.1 6/ PA4.1 RESTROOM 102 RESTROOM 101 06.02 FF: 0' - 0"FF: 0' - 0" NEW WALL , REFER TO WALL LEGEND TYPE PROPOSED WINDOW WINDOW / STOREFRONT TAG. REFER TO WINDOW SCHEDULE OR STOREFRONT LEGEND 1 PROPOSED DOOR DOOR TAG REFER TO DOOR SCHEDULE101a ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:43:58 PMPA2.3 PROPOSED FLOOR PLANLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE PLAN NOTES 1/2" = 1'-0"1PROPOSED FLOOR PLAN KEYNOTES 06.02 LUMBER PERGOLA ABOVE, SEE ROOF PLAN. LEGEND 1. REFER TO FF&E PLAN FOR EQUIPMENT LAYOUT, DIMENSIONS, ETC. 2. REFER TO INTERIOR ELEVATIONS FOR ADD'L DIMENSIONS DESCRIBING PARTIAL HT WALLS, CASEWORK LAYOUT, SPECIALTY OUTLET LOCATIONS, ETC. 3. REFER TO REFLECTED CEILING PLANS FOR SOFFITS, CLG HTS & PLENUM BARRIER LOCATIONS. 4. REFER TO GENERAL INFORMATION AND CONSTROCTION NOTES SHEETS FOR ADD'L NOTES, LEGENDS, SYMBOLS, ABBREVIATIONS, & SCHEDULES.Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/25Page 683 WALL TYPE STUD SIZE: 1 - 1 5/8" 2 - 2 1/2" 3 - 3 5/8" 4 - 4" 5 - 5 1/2" 6 - 6" 8 - 8" WALL HEIGHT: F - TO UNDERSIDE OF STRUC. ABOVE B - 6" ABOVE HIGHEST ADJ. CEILING U - UNDER CEILING P - PONY WALL,HT. PER WALL TAG HR. OF FIRE RATED P1-3 H # 36" PONY WALL HEIGHT, T.O.FINISH (WHERE OCCURS) PARTITION WALLS P1: ONE ROW OF STUD W/ ONE LAYER OF TYPE 'X' GYP. BD. EACH SIDE P2: ONE ROW OF STUD W/ ONE LAYER OF WATER-RESISTANT GYP BD. ON WET SIDE AND ONE LAYER OF TYPE 'X' GYP BD. ON DRY SIDE P3: ONE ROW OF STUD W/ ONE LAYER OF WATER-RESISTANT GYP BD. EACH SIDE INTERIOR WALL TYPES: INTERIOR WALL TYPE TAG: INTERIOR WALLS E1: 14" CONC. 3 HR FIRE-RATED WALL E2: 12" CONC. 3 HR FIRE-RATED WALL E3: ONE ROW OF 6" METAL STUD W/ 5/8" DENSE GLASS ON EXT. SIDE E4: ONE ROW OF 6" METAL STUD W/ 5/8" DENSE GLASS ON EXT. SIDE, 2 LAYRES OF 5/8" TYPE "X" GYP. BD. ON INT. SIDE EXTERIOR WALL TYPES: EXTERIOR WALL TYPE TAG: EXTERIOR WALLS E1 48" PONY WALL HEIGHT,T.O. FINISH (WHERE OCCURS) WALL TYPE PA3.1 3 PA3.1 1 PA3.1 4 PA3.1 2 10' - 4"10' - 4" 21' - 2"3' - 6"8' - 9"5' - 7"5' - 7"1' - 4"5' - 7"5' - 7"1' - 4"0' - 2"0' - 2"0' - 2"0' - 2"3' - 6"8' - 9"12' - 3"12' - 3"10' - 7"10' - 7" 1' - 3"3' - 0"1' - 11" 6' - 1"8' - 6"6' - 1" 21' - 2" 2' - 5"3' - 0"0' - 9"TO CENTER OF POST6' - 6"-P3 F6 06.02 NEW WALL , REFER TO WALL LEGEND TYPE LUMBER PERGOLA ABOVE ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:43:59 PMPA2.4 PROPOSED DIMENSIONED FLOOR PLAN & WALL TYPESLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE KEYNOTES 06.02 LUMBER PERGOLA ABOVE, SEE ROOF PLAN. PLAN NOTES LEGEND 1/2" = 1'-0"1PROPOSED DIMENSIONED FLOOR PLAN WALL TYPES 1. REFER TO FF&E PLAN FOR EQUIPMENT LAYOUT, DIMENSIONS, ETC. 2. REFER TO INTERIOR ELEVATIONS FOR ADD'L DIMENSIONS DESCRIBING PARTIAL HT WALLS, CASEWORK LAYOUT, SPECIALTY OUTLET LOCATIONS, ETC. 3. REFER TO REFLECTED CEILING PLANS FOR SOFFITS, CLG HTS & PLENUM BARRIER LOCATIONS. 4. REFER TO GENERAL INFORMATION AND CONSTROCTION NOTES SHEETS FOR ADD'L NOTES, LEGENDS, SYMBOLS, ABBREVIATIONS, & SCHEDULES.Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/25Page 684 PA3.1 3 PA3.1 1 PA3.1 4 PA3.1 2 4" / 12"4" / 12"7' - 4"7' - 4"23' - 0"4"4"21' - 5"6' - 7"TYP. 1' - 2" 07.01 06.01 07.02 07.02 ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:44:00 PMPA2.6 PROPOSED ROOF PLANLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE 1/2" = 1'-0"1PROPOSED ROOF PLAN 1. REFER TO GENERAL INFORMATION AND CONSTRUCTION NOTES SHEETS FOR ADD'L NOTES, LEGENDS, SYMBOLS, ABBREVIATIONS, & SCHEDULE. 2. REFER TO MEP ROOF TOP EQUIPMENT LAYOUT, DIMENSIONS, ETC. PLAN NOTES LEGEND KEYNOTES 06.01 LUMBER PERGOLA 07.01 SPANISH-STYLE TERRACOTTA CLAY TILE ROOFING 07.02 GUTTER AND DOWNSPOUT Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/25Page 685 COLOR: A CEMENT PLASTER MANUFACTURER: COLOR: B STONE VENEER MANUFACTURER: COLOR: C TERRACOTTA TILE ROOF MANUFACTURER: COLOR: D TIMBER TRELLIS MANUFACTURER: GROUND 0' -0" ROOF RIDGE 12' -8" B.O. FASCIA 9' -9" T.O. STONE 2' - 6" T.O. TRELLIS ± 8' - 4"3' - 6"4' - 6"6"2"8' - 0"08.01 05.01 GROUND 0' -0" ROOF RIDGE 12' -8" B.O. FASCIA 9' -9" T.O. STONE 2' - 6" T.O. TRELLIS ± 8' - 4"SCONCE 5' - 6" A.F.F. TYP.05.01 05.01 05.0105.01 GROUND 0' -0" ROOF RIDGE 12' -8" B.O. FASCIA 9' -9" T.O. STONE 2' - 6" T.O. WINDOW 8' - 0" 08.01 05.01 GROUND 0' -0" ROOF RIDGE 12' -8" B.O. FASCIA 9' -9" T.O. STONE 2' - 6" 05.0105.01 ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:44:03 PMPA3.1 PROPOSED EXTERIOR ELEVATIONSLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE MATERIAL LEGENDKEYNOTES 05.01 CUSTOM FABRICATED WROUGHT IRON GRILL 08.01 TEXTURED PRIVACY GLASS Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/251/2" = 1'-0"3WEST SIDE - EXTERIOR ELEVATION 1/2" = 1'-0"1FRONT - EXTERIOR ELEVATION 1/2" = 1'-0"4EAST SIDE - EXTERIOR ELEVATION 1/2" = 1'-0"2BACK - EXTERIOR ELEVATION Page 686 CASEWORK, REFER TO FF&E PLAN FINISH TAG, REFER TO FINISH LEGENDXY-# ACCENT WALL FINISH, REFER TO FINISH PLAN ACCESSORIES & PLUMBING TAG, REFER TO ACCESSORIES & PLUMBING SCHEDULE XY-## 1/ A101 ELEVATION MARKER RESTROOM 102 BAR 100 60" MIN.5' - 1"48" MIN. 7' - 1"18" MIN.1' - 6"2/ PA4.13/ PA4.14/ PA4.1 5/ PA4.1 6/ PA4.1 PB-01 18" MIN.1' - 6"RESTROOM 101 PB-03 PB-02 RA-0118" MIN.1' - 6"60" MIN.5' - 1"18" MIN.1' - 6"48" MIN. 7' - 1" PB-03 RA-02 RA-02 RA-01 BA-01BA-01 RA-05 RA-04RA-03PB-01RA-04 RA-03 RA-05 EQEQRA-06RA-06 RA-07 EQEQRA-07 RA-08RA-08 RA-09RA-09 06.02 FF: 0' - 0"FF: 0' - 0" GROUND 0' -0"40" MAX. A.F.F.PAPER DISPENSERS & MIRROR34" MAX. A.F.F.2' - 10"7' - 5"33" - 36" MAX. A.F.F.2' - 10"7"B.O. CEILING SEE RCP GROUND 0' -0"7' - 5"7"B.O. CEILING SEE RCP GROUND 0' -0"7' - 5"4' - 0" MAX. A.F.F.7"B.O. CEILING SEE RCP GROUND 0' -0"2' - 10" MAX. A.F.F.7' - 5"7"B.O. CEILING SEE RCP GROUND 0' -0" BA-01BA-01 B.O. CEILING SEE RCP ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:44:06 PMPA4.1 PROPOSED FF&E FLOOR PLAN & ELEVATIONSLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE LEGENDKEYNOTES 06.02 LUMBER PERGOLA ABOVE, SEE ROOF PLAN. PLUMBING FIXTURE SCHEDULE TAG DESCRIPTION COLOR/FINISH COMMENTS PB-01 ACCESSIBLE FLOOR-MOUNTED WATER CLOSET WHITE SPD. SEE ACCESSIBILITY SHEET FOR ACCESSIBLE REQUIREMENTS. PB-02 ACCESSIBLE FAUCET SPD. SEE ACCESSIBILITY SHEET FOR ACCESSIBLE REQUIREMENTS. PB-03 ACCESSIBLE SINK WHITE SPD. SEE ACCESSIBILITY SHEET FOR ACCESSIBLE REQUIREMENTS. ACCESSORY SCHEDULE TAG DESCRIPTION MANUFACTURER MODEL COLOR/ FINISH COMMENTS BA-01 UNDERCOUNTER REFRIGERATOR FISHER & PAYKEL RS2435V2RT1 RA-01 ACCESSIBLE SOAP DISPENSER KOHLER CO.K-25198-CP RA-02 ACCESSIBLE MIRROR WITH LED BOBRICK B-167 2448 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-03 ACCESSIBLE 36" GRAB BAR BOBRICK B-9806-36 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-04 ACCESSIBLE 42" GRAB BAR BOBRICK B-9806-42 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-05 ACCESSIBLE PAPER TOWEL DISPENSER BOBRICK B-9262.MBLK MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-06 ACCESSIBLE TOILET PAPER DISPENSER BOBRICK B-540 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-07 ACCESSIBLE PAPER TOWEL DISPENSER & TRASH BOBRICK B-38032 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-08 ACCESSIBLE COAT HOOK BOBRICK B-9542 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS. RA-09 ACCESSIBLE TOILET SEAT COVER DISPENSER BOBRICK B-3013 MATTE BLACK REFER TO BUILDING ACCESSIBILITY SHEET FOR ACCESSIBILITY REQUIREMENTS.Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/251/2" = 1'-0"1PROPOSED FLOOR PLAN 1/2" = 1'-0"2RESTROOM 102 - WEST 1/2" = 1'-0"4RESTROOM 102 - NORTH 1/2" = 1'-0"3RESTROOM 102 - EAST 1/2" = 1'-0"5RESTROOM 102 - SOUTH 1/2" = 1'-0"6BAR 100 - NORTH Page 687 EQ EQ 2' - 9"4' - 3"2' - 9"2' - 7"EQEQ2' - 7"R1 R1 R1 R1 EQEQ 2' - 7"EQEQ2' - 7"R1 2' - 9"4' - 3"2' - 9" R1 R1 R1 2' - 0"3' - 9"2' - 0"1' - 8"1' - 2"R2 R2 RA-02 RA-02 RESTROOM 102 BAR 100 RESTROOM 101 9' -0" GYP-1 9' -0" GYP-1 9' -0" GYP-1 TAG SYMBOL TYPE NOTES R1 INTERIOR RECESSED DOWNLIGHT GYPSUM BOARD SPOT ELEVATION W/ MATERIAL X' - XX" MATERIAL T WALL MOUNTED EXIT SIGN W/ EMERGENCY LIGHTX1 GYP-1 SED. SEE FINISH LEGEND FOR FINISH R2 EXTERIOR RECESSED DOWNLIGHT SED. RA-02 MIRROR WITH LED PROVIDE ELECTRICAL FOR MIRROR. SED. ARCHITECTURE A CALIFORNIA CORPORATION 307 Orchard City Dr., Ste 350 Campbell, CA 95008 408.265.5255 JEFFREY EATON ARCHITECT, INC © 2024 E2 ARCHITECTURE Project Number: Date: Sheet Title:Client:Drawn by: Checked by:7/1/2025 1:44:07 PMPA6.1 PROPOSED REFLECTED CEILING PLANLA RINCONADACOMFORT STATION17400 WEDGEWOOD AVE AND 17445 ZENA AVE,LOS GATOS, CA 95032KEVIN BREENMAR. 28, 2025 24072 NS JE 1/2" = 1'-0"1PROPOSED RELECTED CEILING PLAN LEGEND RCP NOTES KEYNOTES 1. REFER TO GENERAL INFORMATION AND CONSTRUCTION NOTES SHEETS FOR ADD'L NOTES, LEGENDS, SYMBOLS, ABBREVIATIONS, & SCHEDULES. 2. REFER TO REFLECTED CEILING PLANS FOR SOFFITS, CLG HTS & PLENUM BARRIER LOCATIONS. 3. EXISTING SHELL & CORE CONSTRUCTION SHOWN w/ POCHE & OR SCREENED.Rev. # DescriptionDatePER TOWN COMMENTS05/23/253 PER TOWN COMMENTS07/01/25Page 688 P 1RW 1DC 1DC 1RW 1RW 1RW 1EU 1RW 1RW 1?? 1ASH1EU 1EU 1EU 1EU 1EU 1RW 1EU 1EU 1EU 1RW 2RW 2EU 1RW 1RW 2AC 3EU 1EU 1EU 1RW 1RW 1RW 1ASH1RW 1?? 1CIP 1RW 1RW 1RW 1LIQ1CIP 1RW 1RW 2RW 2RW 2EU 1RW 2EU 1RW 1RW 3RW 3RW 3RW 1RW 1RW 2C? 2EU 2EU 2RW 2RW 2RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 2RW 2RW 2RW 2RW 2RW 3RW 1RW 1RW 1RW 1B 1B 1RW 3RW 3RW 3ASH 3ASH 3RW 1EU 2RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 2RW 2RW 2RW 2RW 2RW 1?? 1RW 1RW 2RW 2RW 2ASH 2RW 2ASH 1ASH 1RW 2ASH 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 2GP 2P 1RW 2EU 1EU 1EU 1EU 1EU 1EU 1RW 1EU 1EU 1EU 1RW 1RW 1RW 1EU 1EU 1EU 1EU 1EU 1EU 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 3RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 1RW 3RW 2RW 2RW 2RW 1RW 1RW 2RW 2RW 2RW 2?? 2?? 1RW 1RW 2RW 2RW 2RW 1RW 1P 2P 2P 2P 2987356211213141516171018114AREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOTPART OFPROJECTAREA NOT PARTOF PROJECT60' SCVWD EASEMENT10' SEWEREASEMENT40.26' PUBLIC STREET EASEMENT40' ROAD EASEMENTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTOWNER:La Rinconada Country ClubINDEX:COVERIRRIGATION PLANSIP-1 THRU IP-5PINNACLE DESIGN COMPANYLA RINCONADA COUNTRY CLUBLANDSCAPE ARCHITECT:KEY MAP:LANDSCAPE CONSTRUCTION DOCUMENTS77935 Calle Tampico, Suite #202La Quinta, CA 92253760-340-4529ORIGINS GOLF DESIGN18022 Cowan StreetSuite 200Irvine, CA 92614GOLF COURSE ARCHITECT:PLANTING DETAILSPLANTING PLANSNTSPP-114595 Clearview DriveLos Gatos, CA 95032PROJECT: SHEET TITLE:COVERSHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKCOVER SHEET DFKAKA241607-01-25PP-2PP-3PP-4PP-5IRRIGATION DETAILSWIN C H E S T E R B L V D VASONA LAKECOUNTY PARKLA RINCONADACOUNTRY CLUBQUITO R O A D QUITO ROADHWY 85HWY 85HWY 1 7 H W Y 1 7 HWY 9HWY 9HWY 1 7 VICINITY MAP:WIN C H E S T E R B L V D IP-6PP-1 THRU PP-5PD-1 THRU PD-2IP-1IP-2IP-3IP-4IP-5La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA 17400 WEDGEWOOD AVE & 17445 ZENA AVE,LOS GATOS, CA 95032TREE PROTECTION & REMOVAL PLANTP-1 THRU TP-6TP-2TP-3TP-1TP-4TP-5TP-6TREE INVENTORY (TREES 360 DEGREES)TI-1 THRU TI-11TREES 360 DEGREESLisa Edwards & Straun EdwardsPO Box 2280Saratoga, CA 95070ARBORIST:77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 689 WEDGEWOOD AVE.WEDGEWOOD AVE. LOR A D R .17471174811751317515175151752517571176011761117615176711770117889 WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.AREA NOT PARTOF PROJECTXX XX XXXXXXXXXX XXXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXXXX X XXXXXXX XX X X X X X X X X X X X X X XXXXXXXXX X X XXX XXXXXXXXXXXXXXXXX XXX XXXXXXXXXXXXXXXXXXXXXX XXX X X XXXXXXXX XXXXXXXXXXXXXXXXXXX87321QL16SS20SS19SS18SS17SS21SS22SS23SS24SS25SS26SSEC47EC48EC50EC49EC51EC82CA53EC54EC78EC76EC77EC75EC74EC72EC83EC84EC85QI87EC306EC305SS301SS52SS302SS303SS304FV300EC88AB89AB90C91C92C94C93C95SS96C102SS97SS98SS99SS100SS101FR103QA104CD105CD106SS107RL79EC80EC81EC67EC63EC64EC66EC65SS62EC61EC60EC69EC58EC57PYC59EC56E55EC70EC71SS108SS162SS161BP160FV159QA158CD157SS156SS155SS154SS153SS152SS151SSQA109QA110QA112ECB113ESS114ESS115ESS116ESS117AM118EC119EN120EN121E122EC123QI124QD125E126E127QD128QD129QD130QD131QD132QD133QD134EC136QA307QA308QA309SS310QA311QA312QD313EC338SS336SS337EC335SS334SS333SS332SS331SS330EG339EC340PCN341SS342SS343SS344SS345AB86EC68EC73EC135E138EC137EC140E111EXISTING CHAINLINK FENCEEXISTING CHAINLINK FENCEEXISTING CHAINLINK FENCEXXQL946Tree varietyInventory tag number -See sheets TI-1 thru Ti-4 forTree InventoryExisting tree location andcanopy size.Proposed tree removalQL946Tree Protection fencing6' Chain Link for trees in areasdeemed to have moderate to highconstruction impact - see arboristreport for more information.Approximate total - 15,000 lfTree removal due to health or hazard(Coded HR on inventory) Shown forreference to Arborist ReportTree Protection fencingOrange Construction Fence for trees inareas deemed to have low to noconstruction impact - see arboristreport for more information.Approximate total - 13,800 lfPROJECT: SHEET TITLE:TP-1SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE PROTECTION & REMOVAL PLAN1 RMKA1" = 50'-0"KA241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA MATCHLINE TP-3MATCHLINE TP-2 La Rinconada Golf Course Modernization Project TREE PROTECTION & REMOVAL PLAN LEGEND77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.452903-28-2025NOTES:1. HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE ROUTING2. SEE TI-1 THRU TI-11 SHEETS FOR TREES 360 DEGREES' TREE INVENTORYDATED JULY 1, 20253. SEE TREES 360 DEGREES' ARBORIST REPORT DATED JULY 1, 2025 (UNDER SEPARATE COVER)FOR MORE INFORMATIONPage 690 WEDGEWOOD AVE.WEDGEWOOD AVE.MULBERRRY DR. MUL B E R R R Y D R .1721117231172511726517211?1731117323173311735114375173911740517415174311747117245CLEARVIEW DR.CLEARVIEW DR.1725917273172871723117301173151732917345173611450114515CLEARVIEW DR.14527CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.CLEARVIEW DR.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.AREA NOT PARTOF PROJECTXXXXXXXXXXXXXXXXXX X X X X X X X X XXX X X X X XXXXXXXXXXXXXXXXXXXXXX X XXXXXXXXXXXX1SS15QL16SS24SS25SS26SS32SS31SS29SS28SS27SS30SS34SS33EN35EN36ER38ER41EN37EN40EN39SL42 EC43EC44EC45EC46EC47SS758SS759SS760QL923AD761QA762EC763QA764EC765AD766CA767CA768QA769QA770AD771SS772AD773SS775SS774AD776QA777QA778SS779AB780PH781PH782PH783PH784PH785PH786PH787QA788PH789QA790SS829CA830QA832CA831SS833SS834SS835QA837SS836EC838QI839QA840SS841EC842SS843EC866QL867VARIOUS844-865QI868QL869QA907QD908QD909QA910QA911QSS912QL913QL914FU915QD921QL920QA922QL917QL916QL918QL919AD791PH793AD792AD794PH796PH795PH797PH798PH800AD799QA801PH802QA803QA804QA806QL805QA807QA808QA809QA810QA811QA812QI813QI814AD816AD815AD817AD819CA824AD822PC821CA825QI826QA827AD820AD823QA828AD818AD823VARIOUS870-906QD14EXISTING CHAINLINK FENCEPROJECT: SHEET TITLE:TP-2SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKRMKA1" = 50'-0"KA241607-01-25MATCHLINE TP-1 MATCHLINE TP-3 La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLAN 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529NOTE: HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE LAYOUTNOTES:1. HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE ROUTING2. SEE TI-1 THRU TI-11 SHEETS FOR TREES 360 DEGREES' TREE INVENTORYDATED JULY 1, 20253. SEE TREES 360 DEGREES' ARBORIST REPORT DATED JULY 1, 2025 (UNDER SEPARATE COVER)FOR MORE INFORMATIONPage 691 CLEARVIEW DR.CLEAR V I E W D R .CLEARVIEW DR.1451514541 1452 7 14555 14569 1 4 5 8 3 14599CLEARVIEW DR.CLE AR V I EW D R . CLEAR V I E W D R . CLEARVIEW DR. CLEARV I E W D R . CL E A R V I E W D R .AREA NOT PARTAREA NOT PARTOF PROJECTAREA NOT PARTOF PROJECTX XX X XXXXXXXXXXXXXXXXXXXXXX X XX X X X X X X X X XXX XX XXXXXXX X X X XXXXXXXXXXXXXXXXXXXX XXXXXX XXXXXXXXXXXX X XXXXXXXXXXXXX XXXX X XXX XXXX XXXX X XXXXXXXXXXXX X X XXXX XXXXXX X X XX XXXXX X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X XXXX XX X X X X X X X XX X XX XXXXXX XX X X X X XX X X X X XXX X X XXXX X X X XXX XXXXXXXXXXXXXXXXXXXXX XX X X X X X X XX 964SS1SS2QA3SS4SS5SS6CE7SS9SS8SS10SS291QL11QL12QD13SS17SS293SS292SS290SS289SS288QA287SS286SS285SS284152SS151SS150QA149SS147SS148PC164QD163QD165QD146QD145QD143QD144EC141QD142SS166LSS167FV168SS169SS190SS189SS187SS184SS181SS173SS176SS180SS171SS172SS183SS179SS178SS177SS170SS185SS186QD195QD194QD193QA192FV191SS375QA376SSFV667MG668WR669QA670QA671PH672FU673OE675QA674QD688SS681SS683SS684SS682CA678FU677LJ676OE377OE378OE379OE380OE381OE382OE383OE384LI704LI703LI702LI701LI700LI699LI698LI697LI696LI695LI694LI692LI693FU691FU690FU689PAC713QA714SS715SS716PAC717PAC718PAC719PAC720PAC721PAC722PAC723PAC724PAC725PAC726PAC727OE728PAC729PAC730PAC731PACPAC734PAC735PAC736OE737PK738E739QI740SS294SS297SS295SS296SS298SS299SS361PC362SS360FU359SS265SS266SS267SS268SS269BP270BP271QD273SS363SS364SS366SS367SS368SS369SS370SS371SS373SS372SS374SS274SS275SS276SS277SS278SS279SS280SS281SS283SS282312SS344SS345SS346SS347SS348SS350SS349SS351SS352FU353SS354SS355PCN356SS357SS358SS317SS318SS319SS316SS315SS314SS320SS321QI328SS322SS324SS325SS323SS329QSS912913QL914915920QA922QL917916QL919SS326SS327SS365SS188SS174SS175SS182OE385SS679LJ680SS685WOODLAND AREA OUTSIDE OF PROPOSEDPROJECT BOUNDARIES - EXCLUDED FROMPROJECT SCOPE (~ 120 TREES)E138137E139EC140FU686CA687QD14EXISTING FENCEEXISTING CHAINLINK FENCEPROJECT: SHEET TITLE:TP-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKRMKA1" = 50'-0"KA241607-01-25MATCHLINE TP-4 MATCHLINE TP-1La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLAN 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529NOTES:1. HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE ROUTING2. SEE TI-1 THRU TI-11 SHEETS FOR TREES 360 DEGREES' TREE INVENTORYDATED JULY 1, 20253. SEE TREES 360 DEGREES' ARBORIST REPORT DATED JULY 1, 2025 (UNDER SEPARATE COVER)FOR MORE INFORMATIONPage 692 14811146651468114713147291474514761147771479514801KARL AVEKARL AVENATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RD14701NATALYE RDAREA NOT PARTOF PROJECTX X XXXXXXXXXX XXX X XXX XXXX XX XXXXXXXXXX X XX XXXX XXXXXX X XXXXXXXXXXXXXXX X XXX X XXXXXXXXXXXX XXXX XXX XX XXXXXXX XXX X X XXXXXXX XXXXX X X X XXXX XXXXXX X XXX XXX X XXX X X X XX XXXXXXXXX XX XXXXXX X XXXXXXXXXXXXXXXXXXXXXXXXX XXXX XXX XXX XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXXXXXX X X X X X X X X X X X X X X X X X X X X XXXXX X XXXXXX X XXXXX XXXXXXXXXXXXXXXXXXXX XXX XX XXX X XXXXXXXX XXXXXXXXXXX X XXX XXXX XX XX5101811EB200FV199QD198FV197QI196QD195QA406SS407QD408SS409SS413SS414SM411SM412QA410SS415SS416SS417SS419SS418QD401SS402SS405SS404CD403SS420SS421SS422SS423SS424SS425QV426QD427SS606FV397FU396FU398SS399SS638FE639FE640SS641FE642FE643FE645AH644FE646FE647FE648FE650SS649SS651FE652FE654QI655SS653SS656FE657FE658FE659FE660FE661FE662QD400SS560SS562SS561PCN559PCN565SS564SS566SS600SS601SS602QD563SS603SS604SS605SS607SS610SS608SS611SS613SS612SS614SS617SS616SS567SS618SS619PCN595SS596SS597SS598SS599FV395FV394FU392SS375FU393SS390SS389SS388SS387SS386FU391FE663FV664LJ665FE666FV667OE379OE380OE382SS444SS445SS446SS447SS448SS449SS450QD451SS452SS455SS454CL453EC552EC553EC554EC555RL558RL557RL556SS569SS568SS594SS593SS592SSF633SS634SS635QD636SS637MG741MG742MG743LI705LI706LI707LI708LI709LI710LI711PAC712714PAC723PAC724PAC732PAC733SR756SR757LI744LI745LI746LI747BC748BC749SR753SR754SR755SR752SR750SR751SS201SS202SS203SS204SS206SS207QA208FU205QA210QA209SS212SS213QA214QA215SS216SS217SS218SS219SS220SS221SS222SS223SS224SS225SS226SS227SS228SS229SS230SS231QD232QA233LI262QA263QL264SS265EC272SS234SS236SS235SS237SS243SS244SS440FV429FV430CA431SS432CB433SS434SS435SS436SS437SS438SS439SS441SS442SS443SS240SS239SS245LI246248249250251252253254EC428SS241SS242247SS609FV932FV933FV934FV935FV936FV937FV938FV939FV940FV941FV942FV943FV944FV945QD946OE385SS615WOODLAND AREA OUTSIDE OF PROPOSEDPROJECT BOUNDARIES - EXCLUDED FROMPROJECT SCOPE (~ 29 TREES)AREA OUTSIDE OF PROPOSED PROJECTBOUNDARIES - EXCLUDED FROMPROJECT SCOPE (80 - 100 TREESS)CA687261260259258257256255LILILILILILILILILILILILILILILISS238EXISTING CHAINLINK FENCEEXISTING FENCEEXISTING FENCEEXISTING FENCEPROJECT: SHEET TITLE:TP-4SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKRMKANOT TO SCALE - THIS SHEET ONLYKA241607-01-25MATCHLINE TP-5 MATCHLINE TP-3La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLAN 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529NOTES:1. HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE ROUTING2. SEE TI-1 THRU TI-11 SHEETS FOR TREES 360 DEGREES' TREE INVENTORYDATED JULY 1, 20253. SEE TREES 360 DEGREES' ARBORIST REPORT DATED JULY 1, 2025 (UNDER SEPARATE COVER)FOR MORE INFORMATIONPage 693 14825148551488514931149611497117 3 5 0 NATALYE RDNATALYE RDFAIRWAY CIR.14980KARL AVE14960KARL AVE14908KARL AVE14833KARL AVENATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDX X XX XXX X XXXXXXX XXX XXXX X XXXXXXXXX XX XXXX XX X XXXXXXXX XXXX X XXXXXXXXXX X XX X XXX X X X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX XXX XXXX X X X XXXXXXXXXXX X X XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX12 151617EC474EC475EC476EC477E478E479QA473QL472EC480EC481CD482SS528SS527SS526SS525EC518LI519SS520SS521SS522SS523OE524SS529SS530EC531EC532EC533EC534EC535EC536EC537EC538EC539EC540EC541SS456EC457EC458EC459EC460EC461SS465EC466QD471EC468EC469EC467EC464EC470SS542SS543EC544EC545EC546EC547EC548EC549EC550EC551552557RL556569SS591SS590SS588SS589SS587SS586SS583SS584PCN585PCN627SS628SS629PCN630SS631SS632F633F620OE621OE622OE623QA624QA625QA626SS579SS578SS577SS576SS575SS573SS574SS571SS572SS570SS580SS581SS582SS924EC463EC462EXISTING FENCEEXISTING FENCEEXISTING FENCEEXISTING FENCEEXISTING FENCEEXISTING FENCEEXISTING FENCEPROJECT: SHEET TITLE:TP-5SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKRMKA1" = 50'-0"KA241607-01-25 MATCHLINE TP-4MATCHLINE TP-6La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLAN 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529NOTES:1. HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE ROUTING2. SEE TI-1 THRU TI-11 SHEETS FOR TREES 360 DEGREES' TREE INVENTORYDATED JULY 1, 20253. SEE TREES 360 DEGREES' ARBORIST REPORT DATED JULY 1, 2025 (UNDER SEPARATE COVER)FOR MORE INFORMATIONPage 694 1 7 3 9 9 1 7 4 0 5 1 7 4 2 3 1 7 4 4 5 ZENA A VE ZENA A VE Z E N A A V EEATON LN1753917551175731760517605FAIRWAY CIR.17635FAIRWAY CIR.Z EN A A V E Z EN A A V EAREA NOT PARTOF PROJECTX X X X X XXXXX X X X X XXXXXX X X X X X X XXXXXX X X XXXXXX XXX XXXXXX X XXXXXXXXXXXXXXXXXXX X XXXX XXX XX1314E479SS483EC484RL487FU486FV485EV497EV496EC495SS494SS493FU488SS489FV490PSS491CA492SS498SS499SS500SS501SS502SS503SS504SS505SS506SS507SS508OE509OE512OE511OE510QA513QA514QA515EC516EC517518EC535EC925EP926EC927EC928EC929SS930EC931EXISTING FENCEEXISTING FENCE Sec. 29.10.1005. - Protection of trees during construction.(a) Protective tree fencing shall specify the following:(1) Size and materials. Six (6) foot high chain link fencing, mounted on two-inch diameter galvanized iron posts, shallbe driven into the ground to a depth of at least two (2) feet at no more than ten-foot spacing. For paving area that willnot be demolished and when stipulated in a tree preservation plan, posts may be supported by a concrete base.(2) Area type to be fenced. Type I: Enclosure with chain link fencing of either the entire dripline area or at the treeprotection zone (TPZ), when specified by a certified or consulting arborist. Type II: Enclosure for street trees located in aplanter strip: chain link fence around the entire planter strip to the outer branches.(3) Duration of Type I, II, III fencing. Fencing shall be erected before demolition, grading or construction permits areissued and remain in place until the work is completed. Contractor shall first obtain the approval of the project arboriston record prior to removing a tree protection fence.(4) Warning sign. Each tree fence shall have prominently displayed an eight and one-half-inch by eleven-inch signstating: "Warning—Tree Protection Zone—This fence shall not be removed and is subject to penalty according to TownCode 29.10.1025."(b) All persons, shall comply with the following precautions:(1) Prior to the commencement of construction, install the fence at the dripline, or tree protection zone (TPZ) whenspecified in an approved arborist report, around any tree and/or vegetation to be retained which could be affected bythe construction and prohibit any storage of construction materials or other materials, equipment cleaning, or parkingof vehicles within the TPZ. The dripline shall not be altered in any way so as to increase the encroachment of theconstruction.(2) Prohibit all construction activities within the TPZ, including but not limited to: excavation, grading, drainage andleveling within the dripline of the tree unless approved by the Director.(3) Prohibit disposal or depositing of oil, gasoline, chemicals or other harmful materials within the dripline of or indrainage channels, swales or areas that may lead to the dripline of a protected tree.(4) Prohibit the attachment of wires, signs or ropes to any protected tree.(5) Design utility services and irrigation lines to be located outside of the dripline when feasible.(6) Retain the services of a certified or consulting arborist who shall serve as the project arborist for periodic monitoringof the project site and the health of those trees to be preserved. The project arborist shall be present wheneveractivities occur which may pose a potential threat to the health of the trees to be preserved and shall document all sitevisits.(7) The Director and project arborist shall be notified of any damage that occurs to a protected tree during constructionso that proper treatment may be administered.(Ord. No. 2240, § I(Exh. B), 6-2-15)PROJECT: SHEET TITLE:TP-6SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKRMKA1" = 50'-0"KA241607-01-25 MATCHLINE TP-5La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA TREE PROTECTION & REMOVAL PLAN 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529 TOWN OF LOS GATOS TREE PROTECTION ORDINANCENOTES:1. HOLE NUMBERS REFLECT THE EXISTING GOLF COURSE ROUTING2. SEE TI-1 THRU TI-11 SHEETS FOR TREES 360 DEGREES' TREE INVENTORYDATED JULY 1, 20253. SEE TREES 360 DEGREES' ARBORIST REPORT DATED JULY 1, 2025 (UNDER SEPARATE COVER)FOR MORE INFORMATIONPage 695 PROJECT: SHEET TITLE:TI-1SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 696 PROJECT: SHEET TITLE:TI-2SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 697 PROJECT: SHEET TITLE:TI-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-17-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 698 PROJECT: SHEET TITLE:TI-4SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 699 PROJECT: SHEET TITLE:TI-5SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 700 PROJECT: SHEET TITLE:TI-6SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-17-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529LargeProtectedPage 701 PROJECT: SHEET TITLE:TI-7SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 702 PROJECT: SHEET TITLE:TI-8SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 703 PROJECT: SHEET TITLE:TI-9SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 704 PROJECT: SHEET TITLE:TI-10SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Page 705 PROJECT: SHEET TITLE:TI-11SHEET NO:DATE:REVISIONS:SSCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOKTREE INVENTORY RM241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization Project ARBORIST OF RECORD - LISA EDWARDS - TREES 360 DEGREES 77935 CALLE TAMPICO,SUITE 202, LA QUINTA, CA.92253 760.340.4529Reason for Tree Removal Per Division 2. - Tree ProtectionSec. 29.10.0992.- Required Findings:(1) The tree is dead, severely diseased, decayed or disfigured to such an extent that the tree is unable to recover or return to a healthyand structurally sound condition.(3) The tree is crowding other protected trees to the extent that removal or severe pruning is necessary to ensure the long-term viabilityof adjacent and more significant trees.(4) The retention of the tree restricts the economic enjoyment of the property or creates an unusual hardship for the property owner byseverely limiting the use of the property in a manner not typically experienced by owners of similarly situated properties, and the applicant hasdemonstrated to the satisfaction of the Director or deciding body that there are no reasonable alternatives to preserve the tree.(10) The removal of the tree and replacement with a more appropriate tree species will enhance the Town's urban forest.Sec. 29.10.0970.- Exceptions:The following trees are excepted from the provisions of this division and may be removed or severely pruned without Town approval or issuance ofa tree removal permit:(2) Any of the following trees that are less than twenty-four (24) inches in diameter (seventy-five (75) inches in circumference):Black Acacia (Acacia melanoxylon)Tulip Tree (Liriodendron tulipifera)Tree of Heaven (Ailanthus altissima)Blue Gum Eucalyptus (E. globulus)Red Gum Eucalyptus (E. camaldulensis)Other Eucalyptus sp. (E. spp.) Hillsides onlyPalm (except Phoenix canariensis)Privet (Ligustrum lucidum)The letter E for Exception is used to identify the removal of a tree that must be identified in the Architectural & Site Review application. However, aTree Removal Permit is not required for removal due to the size and/or undesirable species listed abovePage 706 WEDGEWOOD AVE.MU L B E R R R Y D R .173911740517415174311747117481175131751517515CLEARVIEW DR.1450114515CLEARVIEW DR.14541 1452 7 CLEARV I E W D R . CLEARV I E W D R . CLE A R V I E W D R .CLEARVIEW DR.WEDGEWOOD AVE.WEDGEWOOD AVE.1"1"1"1"-11"-21"461"4-51"5871"8961"91031"10-141"144151"15PROJECT: SHEET TITLE:IP-1SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN DFKA1" = 50'-0"KA241607-01-25MATCHLINE IP-2MATCHLINE IP-3MATCHLINE IP-2 SEE SHEET IP-2 FOR IRRIGATION LEGENDSEE SHEET IP-6 FOR IRRIGATION DETAILSLa Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA MATCHLINE IP-2Page 707 W E D G EW O O D A V E .176011761117615LA RINCONADA PARKGRANADA WAY101 WEDGEWOOD AVE.WEDGEWOOD AVE.1"1"761"6-71"71361"13-141"14SYMBOLMANUFACTURER/MODEL/DESCRIPTIONQTYPSIRAIN BIRD 1802-1400 FLOODFLOOD BUBBLER 2IN. POPUP, INSTALL W/ PA-80 ADAPTER.33050SYMBOL MANUFACTURER/MODEL/DESCRIPTIONQTYRAIN BIRD XCZ-100-IVMQWIDE FLOW IVM DRIP CONTROL KIT FOR COMMERCIALAPPLICATIONS. 1IN. BALL VALVE WITH 1IN. PESBIVMSMART VALVE W/ FACTORY INSTALLED IVM-SOL 0.3-20GPM AND 1IN. PRESSURE REGULATING 40PSIQUICK-CHECK BASKET FILTER 0.3-20 GPM20HUNTER AFV-TAUTOMATIC FLUSH VALVE WITH 1/2IN. MPT CONNECTION.REMOVABLE TOP FOR DIAPHRAGM MAINTENANCE.40HUNTER PLD-AVRPLD-AVR ALLOWS FOR AIR TO ESCAPE A RESIDENTIAL DRIPIRRIGATION SYSTEM TO PREVENT BLOCKAGE AND WATERHAMMERING. 1/2IN. MPT CONNECTION WITH 80 PSIMAXIMUM RATING.6AREA TO RECEIVE DRIP EMITTERSHUNTER HEB1/2IN. FEMALE THREADED POINT SOURCE DRIP EMITTER.COLOR CODED EMITTERS FOR FLOW RATES OF 0.5 GPH -6.0 GPH. RECOMMENDED PRESSURE FROM 20 PSI-50PSI. OPTIONAL DIFFUSER CAP (HE) AVAILABLE FOR HIGHERFLOWS AND CLOG PROTECTION. ON IH-12 RISER178,873 SFSYMBOL MANUFACTURER/MODEL/DESCRIPTIONQTYRAIN BIRD PESB-IVM1IN., 1-1/2IN., 2IN. PLASTIC INDUSTRIAL SMART VALVESW/ FACTORY INSTALLED IVM-SOL. LOW FLOW OPERATINGCAPABILITY, GLOBE CONFIGURATION. WITH SCRUBBERTECHNOLOGY FOR RELIABLE PERFORMANCE IN DIRTYWATER IRRIGATION APPLICATIONS.29PRESSURE REDUCING VALVE1" ZURN WILKENS 500 XL BRASS PRESSURE REDICINGVALVE35IRRIGATION LATERAL LINE: PVC SCHEDULE 4018,507 LFIRRIGATION MAINLINE: PVC SCHEDULE 802,208 LFPIPE SLEEVE: PVC SCHEDULE 40TYPICAL PIPE SLEEVE FOR IRRIGATION PIPE. PIPE SLEEVESIZE SHALL ALLOW FOR IRRIGATION PIPING AND THEIRRELATED COUPLINGS TO EASILY SLIDE THROUGH SLEEVINGMATERIAL. EXTEND SLEEVES 18 INCHES BEYOND EDGESOF PAVING OR CONSTRUCTION.51.2 LFIRRIGATION SCHEDULEPOINT OF CONNECTION FROM MAINLINE OR SUBMAIN35NOTE:CONTRACTOR TO INCLUDE IN THE BID 15 SPOT IN FIELD TREESNOT SHOWN ON PLAN. EACH TREE WILL RECEIVE 2 1402BUBBLERS.CONTRACTOR TO ADD ONE ADDITIONAL POINT OF CONNECTIONTO BID. NOT SHOWN ON PLANSPROJECT: SHEET TITLE:IP-2SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN DFKA1" = 50'-0"KA241607-01-25MATCHLINE IP-1NOTE:1. PDC WILL PROVIDE SITE VISITS FORASTHETIC DIRECTION FOR THE GOLFCOURSE LANDSCAPE. PDC WILL BEAVAILABLE TO PROVIDE TECHNICALSUPPORT DURING THE INSTALLATION BYDAYS ON SITE OR THROUGH EMAIL. PDCRECOMMENDS THE GOLF COURSE HIREA LANDSCAPE IRRIGATION FOREMAN TOOVERSEE THE INSTALLATION OF THELANDSCAPE IRRIGATION AND AS-BUILTALL THE NEW LANDSCAPE IRRIGATION TOENSURE THE INSTALLATION IS PER OURDESIGN AND MEETS THE CLUBSEXPECTATION.2. LANDSCAPE CONTRACTOR MUSTTRENCH AND INSTALL THE FIRST THREEVALVES, PIPE AND FITTINGS, LEAVE THETRENCH OPEN FOR REVIEW ANDAPPROVAL PRIOR TO BACKFILLING.LANDSCAPE CONTRACTOR TO DO THISFOR THE SPRAY SYSTEM, THE TREEBUBBLER SYSTEM AND SHRUB DRIPSYSTEM. GOLF COURSESUPERINTENDENT WILL APPROVE ALLLANDSCAPE IRRIGATION.(or equal)(or equal)(or equal)(or equal)(or equal)(or equal)La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA MATCHLINE IP-1Page 708 CLEAR V I E W D R .CLEARVIEW DR.14555 14569 1 4 5 8 3 14599146651468114713NATALYE RDNATALYE RDNATALYE RDNATALYE RD14701NATALYE RDCLEARVIEW DR.CLE AR V I EW DR . CLEARV I E W D R . CLEARVIEW DR.1"1"1031"11-1"111261"12-171"1716181"181923-1"232481"2425-1"251"1"PROJECT: SHEET TITLE:IP-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN DFKA1" = 50'-0"KA241607-01-25MATCHLINE IP-1MATCHLINE IP-4La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA MATCHLINE IP-2 MATCHLINE IP-1SEE IP-2 FOR LEGENDSAND SCHEDULESPage 709 14811147131472914745147611477714825147951485514885NATALYE RD14908KARL AVE14833KARL AVE14801KARL AVEKARL AVENATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RD1"1"1"1"1"1941"1920-1"202181"213221"2223-1"232481"2426-1"2627-1"277281"283441"444451"451"PROJECT: SHEET TITLE:IP-4SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN DFKA1" = 50'-0"KA241607-01-25MATCHLINE IP-3MATCHLINE IP-5La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA SEE IP-2 FOR LEGENDSAND SCHEDULESPage 710 1488514931149611497117 3 5 0 1 7 3 9 9 1 7 4 0 5 1 7 4 2 3 1 7 4 4 5 ZENA A VE ZENA A VE Z EN A A V E17551175731760517605FAIRWAY CIR.17635FAIRWAY CIR.14980KARL AVE14960KARL AVE14908KARL AVENATALYE RDNATALYE RDNATALYE RDNATALYE RDZ E N A A V E Z EN A A V E 1"1"1"1"1"1"1"1"1"1"1"2941"2930-1"305311"315321"323311"333441"3435-1"353641"361"3781"3738-1"383951"392401"402411"41-421"424.5431"43PROJECT: SHEET TITLE:IP-5SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN DFKA1" = 50'-0"KA241607-01-25MATCHLINE IP-4SEE IP-2 FOR LEGENDSAND SCHEDULESLOS GATOS, CALIFORNIA La Rinconada Golf Course Modernization ProjectPage 711 QUICK COUPLING VALVE BOX, TYP.14"X19" RECTANGULAR VALVE BOX TYP.12" TYP.12"12"12"12"NOTE:3. SET BOXES PARALLEL TO EACH OTHER AND PERPENDICULAR TO EDGE.SECTION VIEW - N.T.S.1. CENTER VALVE BOX OVER REMOTE CONTROLVALVE TO FACILITATE SERVICING VALVE.2. SET RCV AND VALVE BOX ASSEMBLY INGROUND-COVER/SHRUB AREA WHERE POSSIBLE.4. AVOID HEAVILY COMPACTING SOIL AROUND VALVE BOXES TOPREVENT COLLAPSE AND DEFORMATION OF VALVE BOXES.5. COLOR OF BOX TO BE TAN IN THE LANDSCAPE AND GREEN INTURF AREAS(2")(2") MIN.FINISHED GRADEIN SHRUB AREAS(2")FINISH GRADE IN TURF AREASHEAT BRAND "RCV" AND CONTROL STATION # ONTO LID.CAPTIVE STAINLESS STEEL BOLT AND LOC-KIT. INSTALLPLASTIC RECTANGULAR VALVE BOX WITH T-COVER ANDBOX AT RIGHT ANGLE TO ADJACENT HARDSCAPE EDGE.Maxicom WireSCH. 80 PVC SLIPSCH. 40 PVC PIPE ORTAPE WIRE TO PIPESCH. 80 T.O.E. NIPPLE90 DEGREE ELLWITH D.I. SERVICE TEELANDSCAPE FABRIC TO19mm (3/4") CRUSHED GRAVEL,100mm (4") MINIMUM DEPTHCOVER BOTTOM AND ALLSIDES OF VALVE BOXBRICK SUPPORTS,4 REQUIREDLASCO #896 PVC UNIONSLIP X MIPT, SIZE PER RCV,ELECTRIC REMOTE CONTROLVALVE, SEE LEGEND FOR TYPE2 REQUIRED FOR ASSEMBLYSIZE PER PLANS,TYPE PERMIN.PVC PIPE,USE STANDARD BOX OPENINGSFOR PIPE, DONOT CUT BOXLEGEND50 mm50 mm50 mmCABC C C CPRESSURE MAINLINE, SEECONTROL WIRES, SEE SPECS.LATERAL LINES, SEE SPECS.CLEAN COMPACTED BACKFILL(4")(24")CBADIMENSIONFINISH GRADESPECIFICATIONSUNDISTURBED SOILSECTION VIEW - N.T.S.(18") (12")13mm (1/2") TO 65mm (2.5") IN SIZE75mm (3") TO 150mm (6") IN SIZE100mm100mm(4")300mm400mm600mmPRESSURE MAINLINEINSTALLED IN ROCK SOIL.OF THE PIPE OR WIREDETAIL ALSO FOR PIPEIN SCH 40 SLEEVEPVC SLEEVES TO BETWICE THE DIAMETERBUNDLE CARRIED.13mm (1/2") TO 150mm (6") IN SIZEDIMENSION(4")(24")(24")(36")DCBASAND BACKFILL COMPACTEDPAVINGUNDISTURBED SOILTO THE DENSITY OFLATERAL LINESCONTROL WIRESIN SCH 40 SLEEVEIN SCH 40 SLEEVEEXISTING SOILBCD D D DASECTION VIEW - N.T.S.NOTE:SLEEVES TO EXTEND AT LEAST 300mm (12") PAST THE EDGE OF THE PAVING.100mm600mm600mm900mmKIT SHALL INCLUDE A SCOTCHLOK Y SPRING CONNECTOR, A POLYPROPYLENE TUBE AND A WATERPROOF SEALING GEL. TUBE SHALL BE SUPPLIED PREFILLED WITH GEL.WIRE CONNECTOR SHALL BE A 3M DBY-6 DIRECT BURY SPLICE KIT (U.L. APPROVED).NOTE:INSERTED INTO TUBE UNTIL THESCOTCHLOK CONNECTOR AND WIRESCONNECTOR PASSES LOCK TABSWATERPROOF GELPOLY TUBE PRE-FILLED WITHONCE CONNECTOR IS INSERTEDLOCK TABS PREVENT WIRE REMOVAL SCOTCHLOK ELECTRICAL SPRINGCONNECTOR. WIRES SHALL BEPRE-STRIPPED OF 1/2" OF THE INSULATION PRIOR TO INSERTION CONNECTOR ONTO WIRES TO INTO THE CONNECTIOR. TWIST SEAT FIRMLY.IS INSERTED INTO TUBEWIRES PASS THROUGH GROOVES INTUBE LID TO ALLOW LID TO CLOSECLOSE TUBE LID AFTER WIRELOW VOLTAGE WIRES, 3 MAXIMUMSECTION VIEW - N.T.S.DIRECT BURY SPLICE KIT SHALL BE USED TO ELECTRICALLY CONNECT 2 - 3 #14 OR 2 #12 PRE-STRIPPED COPPER WIRES. LARGER WIRES OR GREATER QUANTITIES OF WIRES SHALL REQUIRE A LARGER APPROVED WIRE CONNECTION.LANDSCAPE IRRIGATION MANIFOLD PLAN VIEWLANDSCAPE FABRIC TOCOVER BOTTOM AND ALLSIDES OF VALVE BOXLANDSCAPE FABRIC TOCOVER BOTTOM AND ALLSIDES OF VALVE BOXLANDSCAPE FABRIC TOCOVER BOTTOM AND ALLSIDES OF VALVE BOXHDPE MAINLINE PIPESEE PLAN VIEW FOR LANDSCAPE VALVE ASSEMBLYSECTION VIEW - N.T.S.EXISTING TURFMULCHPROJECT: SHEET TITLE:IP-6SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253IRRIGATION PLAN DFKAKA241607-01-25SEE IP-2 FOR LEGENDSAND SCHEDULESLOS GATOS, CALIFORNIA La Rinconada Golf Course Modernization ProjectPage 712 WEDGEWOOD AVE.LOR A D R . MUL B E R R R Y D R .1739117405174151743117471174811751317515175151752517571CLEARVIEW DR.1450114515CLEARVIEW DR.14541 1452 7 CLEARV I E W D R . CLE A R V I E W D R .CLEARVIEW DR.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.ZONE D - SCREENING NATIVE(25) Heteromeles arbutifolia(11) Rhus integrifoliaQA-448"box1QA-660"box1QV-448"box1A336"box2A224"box2PR-448"box2QA-448"box1QA-660"box1A336"box1QV-448"box2QV-336"box1A224"box1QA-448"box1QA-41QA-224"box1QA-448"box1QA-336"box1QA-660"box1QA-336"box1PR-660"box1A224"box2A336"box3QA-224"box136"boxQA-224"box1QA-336"box1QA-660"box1QA-448"box2QA-336"box2EX STRUCTURESEE PD-2 FOR TYP. PLANTING ENLARGEMENTSEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1QV-448"box1ZONE B - SCREENING WEDGEWOOD AVE(9) Ceanothus x 'Dark Star'(17) Heteromeles arbutifolia(5) Prunus laurocerasus(9) Rhus integrifolia(7) Tagetes lemmonii(20) Westringia fruticosa 'WES03'MULCH ONLYMULCH ONLYMULCH ONLYQA-660"box1QA-660"box1MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYSEE NOTE #1MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)ZONE A - LOW TO MED DENSITY(5) Caryopteris incana(13) Phlomis fruticosa(2) Rhus integrifolia(10) Trichostema lanatum(16) Westringia fruticosa 'WES03'SEE PD-2 FOR TYP. PLANTING ENLARGEMENTZONE A - LOW TO MED DENSITY(2) Caryopteris incana(4) Phlomis fruticosa(1) Rhus integrifolia(3) Trichostema lanatum(5) Westringia fruticosa 'WES03'SEE PD-2 FOR TYP. PLANTING ENLARGEMENTZONE A - LOW TO MED DENSITY(31) Caryopteris incana(75) Phlomis fruticosa(10) Rhus integrifolia(59) Trichostema lanatum(95) Westringia fruticosa 'WES03'QV-336"box1PROJECT: SHEET TITLE:PP-1SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN DFKA1" = 50'-0"KA241607-01-2517400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA MATCHLINE PP-2MATCHLINE PP-3MATCHLINE PP-2 SEE PP-2 FOR LEGENDSAND SCHEDULES, PD-1 FORPLANTING DETAILS/NOTESSEE PD-2 FOR LANDSCAPETYPICAL ENLARGEMENTSLa Rinconada Golf Course Modernization ProjectPage 713 WEDGEWOOD AVE.WEDGEWOOD AVE. LOR A D R .1757117601176111761517889GRANADA WAYWEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.WEDGEWOOD AVE.ZONE D - SCREENING NATIVE(25) Heteromeles arbutifolia(11) Rhus integrifoliaQV-336"box1QA-448"box1QA-660"box1QV-448"box1QA-448"box1QV-336"box1QA-448"box1QA-660"box1QA-224"box1QA-336"box1QA-448"box1QA-224"box1QA-336"box1QV-448"box1QA-660"box1QA-42QA-336"box2EX STRUCTURESEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1SEE NOTE #1ZONE C - SCREENING SHADE(4) Ceanothus x 'Dark Star'(20) Heteromeles arbutifolia(7) Prunus laurocerasusMULCH ONLYMULCH ONLYQA-660"box1QA-660"box1MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MULCH ONLY272,781 SFNO PLANTINGS. 2" THICK WOOD MULCHZONE A - LOW TO MED DENSITY24,409 SFWITH 2" THICK WOOD MULCHZONE B - SCREENING WEDGEWOODAVE4,424 SFNO NEW MULCH HERE. PLANT SHRUBS INEXISTING GROUNDCOVER.ZONE C - SCREENING SHADE3,492 SFWITH 2" THICK WOOD MULCHZONE D1 - SCREENING SHED1,245 SFWITH 2" THICK WOOD MULCHZONE D2 - SCREEN BACK OF HOUSE1,955 SFWITH 2" THICK WOOD MULCHZONE F - 11/12/POOL17,028 SFWITH 2" THICK WOOD MULCHZONE G - 8G/9T SHADY2,049 SFWITH 2" THICK WOOD MULCHZONE H - 12 LOW DENSITY30,519 SFNO MULCH - SHRUBS TO BE PLANTED INGRASSLANDSZONE I - SW CORNER SCREENING10,636 SFWITH 2" THICK WOOD MULCHZONE J - 17T/MAINT5,097 SFWITH 2" THICK WOOD MULCHZONE K - 17 RIGHT SIDE5,660 SFWITH 2" THICK WOOD MULCHZONE L-1 - 18 RIGHT SIDE19,053 SFWITH 2" THICK WOOD MULCHZONE L-2 - 18 RIGHT SIDE7,649 SFWITH 2" THICK WOOD MULCHWOOD MULCH SPECIFICATION: FOREST FLOORSHRUB PLANTING AREASSEE PLANT SCHEDULE FOR SHRUB VARIETIES, QTYS, ANDSIZES. SEE PLAN FOR SHRUB QTYS AND VARIETIES PER ZONE.MEADOW ZONE WITH NO SHRUB PLANTING (SEEORIGINS GOLF PLANS FOR SPECIFICATIONS)SYMBOLCODEBOTANICAL / COMMON NAMECONTQTYTREESA2ARBUTUS UNEDO / STRAWBERRY TREE SHRUBMULTI-TRUNK OR LOW BRANCHING24"BOX13A3ARBUTUS UNEDO / STRAWBERRY TREE SHRUBMULTI-TRUNK OR LOW BRANCHING36"BOX20A4ARBUTUS UNEDO / STRAWBERRY TREE SHRUBMULTI-TRUNK OR LOW BRANCHING48"BOX6PR-4PLATANUS RACEMOSA / CALIFORNIA SYCAMOREMULTI-TRUNK OR LOW BRANCHING48"BOX10PR-6PLATANUS RACEMOSA / CALIFORNIA SYCAMOREMULTI-TRUNK OR LOW BRANCHING60"BOX3QA-2QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING24"BOX10QA-3QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING36"BOX24QA-4QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING48"BOX27QA-6QUERCUS AGRIFOLIA / COAST LIVE OAKMULTI-TRUNK OR LOW BRANCHING60"BOX13QV-3QUERCUS VIRGINIANA / SOUTHERN LIVE OAKFULL AND STANDARD OR LOW BRANCHING36"BOX8QV-4QUERCUS VIRGINIANA / SOUTHERN LIVE OAKFULL AND STANDARD OR LOW BRANCHING48"BOX12QV-6QUERCUS VIRGINIANA / SOUTHERN LIVE OAKFULL AND STANDARD OR LOW BRANCHING60"BOX2QC4QUERCUS VIRGINIANA CATHEDRAL / CATHEDRAL SOUTHERN LIVE OAKFULL, STANDARD48"BOX6QC6QUERCUS VIRGINIANA CATHEDRAL / CATHEDRAL SOUTHERN LIVE OAKFULL, STANDARD60"BOX4VINESCISCISSUS ANTARCTICA / KANGAROO VINE5 GAL17SYMBOLCODEBOTANICAL / COMMON NAMECONTSPACINGQTYSHRUB AREASAUARBUTUS UNEDO / STRAWBERRY TREE SHRUB15 GAL44BBCBUDDLEJA X 'BLUE CHIP' / LO & BEHOLD® BLUE CHIP BUTTERFLY BUSH1 GAL64CAICARYOPTERIS INCANA / COMMON BLUEBEARD5 GAL41CEDCEANOTHUS X 'DARK STAR' / DARK STAR WILD LILAC5 GAL126CEJCEANOTHUS X 'JOYCE COULTER' / JOYCE COULTER WILD LILAC5 GAL16DHDODONAEA VISCOSA / HOPSEED BUSH15 GAL22FRCFRANGULA CALIFORNICA / CALIFORNIA COFFEEBERRY5 GAL56GRRGREVILLEA ROSMARINIFOLIA / ROSEMARY GREVILLEA5 GAL109HAHETEROMELES ARBUTIFOLIA / TOYON15 GAL114LLLEONOTIS LEONURUS / LION'S TAIL5 GAL41LSLEUCADENDRON X 'SAFARI SUNSET' / SAFARI SUNSET CONEBUSH5 GAL18PFPHLOMIS FRUTICOSA / JERUSALEM SAGE1 GAL140PPPHLOMIS PURPUREA / PURPLE PHLOMIS1 GAL45PRLPRUNUS LAUROCERASUS / ENGLISH LAUREL15 GAL26RIRHUS INTEGRIFOLIA / LEMONADE BERRY5 GAL186SVSYRINGA VULGARIS / COMMON LILAC5 GAL26TLTAGETES LEMMONII / COPPER CANYON DAISY5 GAL7TWTRICHOSTEMA LANATUM / WOOLLY BLUE CURLS1 GAL76WBWESTRINGIA FRUTICOSA 'WES03' / BLUE GEM COAST ROSEMARY5 GAL513PLANT SCHEDULESEE PLANT PROCUREMENT AND APPROVAL NOTES ON SHEET PD-1NOTE #1TREES PLANTED IN TURF SHALL RECEIVE A WOODMULCH RING AROUND THE TREE THAT EXTENDS 2'BEYOND THE ROOTBALL OF THE TREE.CONTRACTOR TO BUILD A 3-4" HIGH WELL INSIDETHE EDGE OF THE MULCH RING TO HOLD WATERDURING GROW-IN. THE WELL SHOULD BEMAINTAINED FOR AT LEAST A YEAR AFTER PLANTING.NO TREE IN TURF SHALL BE PLANTED WITHIN12' OF A TURF ROTOR.EXISTING TREE TO REMAINSEE TREE DISPOSITION PLANFOR COMPLETE INVENTORY OFTREES TO REMAIN AND TREESTO BE REMOVEDSPOT INFIELD** SPOT IN FIELD TREES IN RESERVE TO BE USED IN LOCATION TO BE DETERMINED BASEDON ARBORIST TREE REMOVAL SUGGESTIONS. NOT SHOWN ON PLAN.243222TOTAL TREES15* +158 =173 PROJECT: SHEET TITLE:PP-2SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN DFKA1" = 50'-0"KA241607-01-25MATCHLINE PP-1MATCHLINE PP-1 SEE PD-1 FOR PLANTING DETAILS/NOTESSEE PD-2 FOR LANDSCAPE TYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization ProjectNOTE:BASED ON THE NUMBER OF TREES PROPOSED FOR REMOVAL COMPARED TO THE PROPOSED NUMBER OF REPLACEMENT TREES,IN-LIEU FEES WILL BE REQUIRED. SEE ARBORIST REPORT AND APPLICANT'S JUSTIFICATON LETTER FOR MORE INFORMATION. Page 714 CLEAR V I E W D R .CLEARVIEW DR.14555 14569 1 4 5 8 3 14599146651468114713NATALYE RDNATALYE RDNATALYE RD14701NATALYE RDCLEARVIEW DR.CL EA R V IEW DR . CLEARV I E W D R . CLEARVIEW DR. ELEC ZONE D2 - SCREEN BACK OF HOUSE(10) Ceanothus x 'Dark Star'(16) Frangula californica(8) Prunus laurocerasusQA-448"box1QC448"box3QC660"box3QA-336"box1QA-448"box1QA-660"box1QA-336"box1QA-448"box1QA-224"box1A336"box2A224"box1A336"box2A224"box1QC660"box1A224"box2A336"box1QA-448"box1QC448"box3ZONE L-2 - 18 RIGHT SIDE(8) Arbutus unedo(15) Ceanothus x 'Dark Star'(20) Grevillea rosmarinifolia(10) Rhus integrifolia(50) Westringia fruticosa 'WES03'QA-448"box2QA-336"box1EX PUMP HOUSERRA224"box2A336"box1A42QA-660"box1QA-448"box1QA-336"box1ZONE F - 11/12/POOL(26) Buddleja x 'Blue Chip'(14) Dodonaea viscosa(27) Leonotis leonurus(12) Leucadendron x 'Safari Sunset'(28) Phlomis fruticosa(46) Westringia fruticosa 'WES03'MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)SEE PD-2 FOR TYP. PLANTING ENLARGEMENTZONE A - LOW TO MED DENSITY(10) Caryopteris incana(24) Phlomis fruticosa(3) Rhus integrifolia(19) Trichostema lanatum(30) Westringia fruticosa 'WES03'PROJECT: SHEET TITLE:PP-3SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN DFKA1" = 50'-0"KA241807-01-25MATCHLINE PP-1MATCHLINE PP-4SEE PP-2 FOR LEGENDS AND SCHEDULES, PD-1 FOR PLANTING DETAILS/NOTESMATCHLINE PP-2SEE PD-2 FOR LANDSCAPE TYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization ProjectPage 715 1481114713147291474514761147771482514795148551488514908KARL AVE14833KARL AVE14801KARL AVEKARL AVENATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDNATALYE RDQA-660"box1QA-448"box1QA-336"box1QA-448"box1QA-336"box1QA-448"box1QA-224"box2QA-336"box1QA-660"box1QA-448"box1QA-224"box1QA-336"box1QV-336"box1QA-224"box1QA-448"box124"boxQV-336"box1ZONE G - 8G/9T SHADY(7) Ceanothus x 'Dark Star'(13) Frangula californica(3) Prunus laurocerasus(8) Westringia fruticosa 'WES03'SEE NEXT SHEETFOR PLANTING QTYSZONE L-1 - 18 RIGHT SIDE(25) Arbutus unedo(37) Ceanothus x 'Dark Star'(20) Phlomis purpurea(39) Rhus integrifolia(26) Syringa vulgaris(108) Westringia fruticosa 'WES03'LAKELAKEQV-448"box1QV-660"box136"boxQA-336"box1QA-660"box1QA-448"box1QA-448"box1QA-336"box1SEE PD-2 FOR TYP. PLANTINGENLARGEMENTQA-336"box2RRSEE NOTE #1A336"box1A448"box1A224"box1A336"box4A448"box2QA-336"box1ZONE F - 11/12/POOL(14) Buddleja x 'Blue Chip'(8) Dodonaea viscosa(15) Leonotis leonurus(6) Leucadendron x 'Safari Sunset'(15) Phlomis fruticosa(25) Westringia fruticosa 'WES03'MULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYMULCH ONLYQA-336"box1MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)MEADOW (BY OTHERS)ZONE C - SCREENING SHADE(2) Ceanothus x 'Dark Star'(8) Heteromeles arbutifolia(3) Prunus laurocerasusPROJECT: SHEET TITLE:PP-4SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING PLAN DFKA1" = 50'-0"KA241807-01-25MATCHLINE PP-3MATCHLINE PP-5SEE PP-2 FOR LEGENDSAND SCHEDULES, PD-1 FORPLANTING DETAILS/NOTESSEE PD-2 FOR LANDSCAPETYPICAL ENLARGEMENTS17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA La Rinconada Golf Course Modernization ProjectPage 716 ˙˙˘˝˝ˇ˝ˆˆ ˘ˆ˝˝ˆ˘ˆˆ˘=(1$$ 9(=(1$$ 9(=(1 $$ 9(1$7$/<(5'($721/1ˆ˘˝ˆ˘˘ˆ˘ˆˆˇ˘ˆˇ˘)$,5:$<&,5ˆˇ˘)$,5:$<&,5˝˙.$5/$9(˝ˇ.$5/$9(.$5/$9(1$7$/<(5'1$7$/<(5'1$7$/<(5'1$7$/<(5'=(1 $$ 9(=(1 $$ 9((;˘7$//5(7$,1,1*:$//%/2&.&21&5(7(9',7&+49ˇˇER[49˙ER[49˙ER[$ˇER[$˙ER[4$˙ER[35ˇˇER[35˙ER[$˙ER[49ˇER[4$ˇER[35˙ER[4$ˇER[4$ER[4$˙ER[4$ˇER[4$˙ER[35˙ER[35ˇˇER[4$ˇˇER[49ˇER[49˙ER[=21(,6:&251(56&5((1,1*$UEXWXVXQHGRˇ&HDQRWKXV['DUN6WDUˇ3KORPLVSXUSXUHDˆ5KXVLQWHJULIROLD˙:HVWULQJLDIUXWLFRVD:(6=21(+81'(56725<˙˝*UHYLOOHDURVPDULQLIROLD+HWHURPHOHVDUEXWLIROLDˇˇ5KXVLQWHJULIROLD&,6˘JDOˆ=21(.ˆ5,*+76,'(%XGGOHMD[%OXH&KLS˝5KXVLQWHJULIROLD˙:HVWULQJLDIUXWLFRVD:(6/$.($ˇER[=21(-ˆ70$,17ˇ&HDQRWKXV['DUN6WDUˆ&HDQRWKXV[-R\FH&RXOWHUˆ)UDQJXODFDOLIRUQLFD4$ˇˇER[4$ˇˇER[4$ˇER[4$˙ER[$ˇER[$ER[49˙ER[6((3')257<33/$17,1*(1/$5*(0(17(;3$7+0$,17(1$1&(*$7(6((127(08/&+21/<08/&+21/<08/&+21/<08/&+21/<08/&+21/<4$˙ER[0($'2:%<27+(560($'2:%<27+(560($'2:%<27+(560($'2:%<27+(560($'2:%<27+(56352-(&7˛ 6+((77,7/(˛33˘6+((712˛'$7(˛5(9,6,216˛6&$/(˛352-0*5&+(&.('˛352-12˛'5$:1˛63(&,),&$7,2166+((7 %22.ˆ˙ˆ+:<68,7(˝ˆˇ˘˝/$48,17$&$˝˘3/$17,1*3/$1 ').$ ˘.$˙ˆ˘0$7&+/,1(336((33)25/(*(1'6$1'6&+('8/(63')253/$17,1*'(7$,/6127(66((3')25/$1'6&$3(7<3,&$/(1/$5*(0(176ˆ:('*(:22'$9(ˆ˘=(1$$9(/26*$726&$ /D5LQFRQDGD*ROI&RXUVH0RGHUQL]DWLRQ3URMHFWPage 717 6"Page 718 15EX TREEWOOD MULCHNEW CANOPYTREE MAY OCCURMEDIUM SHRUBLARGE SHRUBSMALL ACCENT SHRUBSNEW CANOPYTREE MAY OCCURACCESS ROAD / CART ROADTEE BOXTURFTURFNEW CANOPYTREE MAY OCCUREX 5' TALL CHAINLINK FENCE (BLACK)HOMEOWNERLOT - FENCELINEDOES NOT NEED100% SCREENINGHOMEOWNERLOT -FENCELINEAND LOTNEEDSSCREENINGAT 5' TALLHOMEOWNER VIEWHOMEOWNER VIEW INF O R M A L S C R E E N I N G T O SO F T E N H O M E S A N D F E N C E L I N E SMAINTAIN EXISTINGHOMEOWNER VIEWSTO GOLFEX 5' TALL CHAINLINK F E N C E - N O H E D G E 12LARGE SHRUBSMEDIUM SHRUBSEX TREEEX TREECART PATHCART PATHEX TREE CANOPYTURFPLEXISTINGMEADOW/MULCHGROUNDPLANEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCE18LARGE SHRUBSMEDIUM SHRUBSNEW CANOPY TREEEX TREEWOOD MULCHMEDIUM SHRUBLARGE SHRUBSMALL ACCENT SHRUBTEE BOXTEE BOXCART PATHHOMEOWNERLOT - FENCELINEAND LOT NEEDSSCREENING AT 5'TALLHOMEOWNERLOT - CURRENTLYHAS NO VIEW TOGOLFEXISTING 8' TALL HEDGETURFPLPROJECT: SHEET TITLE:PD-2SHEET NO:DATE:REVISIONS:SCALE:PROJ. MGR.CHECKED:PROJ. NO:DRAWN:SPECIFICATIONSSHEETBOOK78370 HWY 111, SUITE 290760.340.4529 LA QUINTA, CA. 92253PLANTING TYPICALS DFKA1" = 20'-0"KA241807-01-25SOFTENING / PARTIAL SCREENING OF RESIDENTIAL(RIGHT OF HOLE 12)LOW -MEDIUM DENSITY TO SCREEN ROAD(BTWN HOLES 1 & 5)FULL SCREENING OF RESIDENTIALFENCELINE - MEDIUM DENSITY(RIGHT OF HOLE 18)THESE ENLARGEMENTS ARE SHOWN TO ILLUSTRATE THE DENSITIES OF SHRUB PLANTING IN OUR PLANTING ZONES.CONTRACTOR IS NOT TO USE THESE ENLARGEMENTS FOR TAKE-OFF PURPOSES. FOLLOW THE QUANTITIES ON THE PP- SHEETS.La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CAPage 719 375380385350350355360365370375380350355360365370370365375375375375380380380380380380375375375370370365365355360380380385385390390390395395395400400400400395395395395370370370370365365365365360360360360355355355350345330370380 375 370 365 360355350345340 33 536069679 1213141516171018111289EX 5 ' T A L L C H A I N L I N K F E N C EEX 6 ' TAL L WOOD FENCE EX 5 ' T A L L W R O U G H T I R O N F E N C E EX 5' T A L L W R O U G H T I R O N F E N C E EX 5' TALL WROUGHT IRON FENCEEX 5 ' T A L L C H A I N L I N K F E N C E EX 5' TALL CHAINLINK FENCE (BLACK)EX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCE (BLACK)ELEC EX 5' TALL WOOD FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCEEX 5' TALL CHAINLINK FENCE (BLACK)EX 5' TALL RETAININ G WALL BL OCK WITH 5' TALL W ROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 6 ' T A L L W O O D F E N C E EXISTING BRIDGELakeFillLakeFillLakeFillLake#1653.045.0 4:1 45464748495051524:145464748495051 52 4:1 5251504948474645VVVVlc4:146.545. 5 44 . 543. 5 42 .541 .540 . 5 39 . 5 3:1Lake#1147.539.539.540.541.542.543.544.545.546.53: 1 39.540.541.542.543.544.545.546.5 3:139.540.541.542.543.544.545.546.53:146.545.544.543.542.541.540.539.53:146.545.544.543.542.541.540.539.5 3:1VVSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK0.1Lake System Site Plan, Notes, etc0'100'200'300'NORTHScale: 1" = 100'LAKE SYSTEM GENERAL NOTES:1. THESE DRAWINGS ARE INTENDED FOR LAKE CONSTRUCTION USE ONLY. SEE DRAWINGS BY RESPECTIVEDESIGNERS FOR OTHER ASPECTS OF CONSTRUCTION.2. IT IS THE INTENT OF THESE DRAWINGS AND THIS DESIGN THAT THE WORK REPRESENTED HERE BE COMPLETEDBY A LICENSED CONTRACTOR WITH EXPERIENCE AND QUALIFICATIONS SPECIFIC TO THIS UNIQUE WORK. THELAKE CONTRACTORS EXPERIENCE AND QUALIFICATIONS SHALL INCLUDE, AT A MINIMUM, THE SUCCESSFULCOMPLETION OF AT LEAST (5) PROJECTS EQUIVALENT IN SCOPE COMPLETED WITHIN THE LAST (2) YEARS ASDETERMINED BY THE OWNER OR HIS REPRESENTATIVE. THE LAKE CONTRACTOR SHALL SUBMIT, WITH HIS BID, ALIST OF QUALIFYING COMPLETED PROJECTS INCLUDING THE NAMES, ADDRESSES, AND PHONE NUMBERS FOR THEOWNER (OR HIS REPRESENTATIVE) AND THE LAKE ENGINEER. THE PROJECT OWNER SHALL MAKE THE FINALDETERMINATION AS TO THE QUALIFYING EXPERIENCE OF THE LAKE CONTRACTOR. FURTHER, IT IS THE INTENT OFTHIS DESIGN TO CONVEY A COMPLETE AND WORKABLE LAKE SYSTEM. THE LAKE CONTRACTORS PRICING SHALLINCLUDE ALL MATERIALS, EQUIPMENT, ACCESSORIES, ETC. REQUIRED TO PRODUCE A COMPLETE AND WORKABLELAKE SYSTEM TO INDUSTRY STANDARDS.3. THE LAKE CONTRACTOR SHALL VERIFY ALL DIMENSIONS, ELEVATIONS, AND CONDITIONS PRIOR TO STARTINGWORK. THE LAKE CONTRACTOR SHALL NOTIFY THE OWNER'S REPRESENTATIVE OF ANY DISCREPANCY IN THEDRAWINGS OR SITE CONDITIONS SO THAT PROPER CLARIFICATIONS CAN BE MADE BEFORE CONSTRUCTIONBEGINS.4. IN ADDITION TO EXAMINING THESE PLANS, THE LAKE CONTRACTOR IS EXPECTED TO HAVE VISITED ANDINSPECTED THE SITE IN ORDER TO DETERMINE THE GRADES AND TRUE CONDITIONS UNDER WHICH THE WORK ISTO BE PERFORMED. SHOULD ANY OMISSIONS, CONFLICTS, OR AMBIGUITIES IN THE DRAWINGS BE DISCOVEREDDURING THE EXAMINATION OF THE DRAWINGS OR UPON VISITING THE SITE, THE OWNER'S REPRESENTATIVESHALL BE NOTIFIED IMMEDIATELY.5. 30 MIL LLDPE-R LAKE MEMBRANE LINER: THE CONTRACTOR SHALL FURNISH AND INSTALL SUFFICIENT LININGMATERIAL TO COVER ALL LINED AREAS SHOWN ON THE PLANS INCLUDING PANEL OVERLAPS AT FIELD SEAMS ANDIN DEPRESSIONS. THE LINING MATERIAL SHALL BE LINEAR LOW DENSITY POLYETHYLENE - REINFORCED (LLDPE-R)MEMBRANE AND SHALL BE MANUFACTURED BY THE CALENDARING PROCESS. THE LINING MATERIAL SHALL BEUNIFORM IN COLOR, THICKNESS, SIZE, AND SURFACE TEXTURE. LINING INSTALLATION SHALL NOT BEGIN UNTIL APROPER BASE HAS BEEN PREPARED TO ACCEPT THE MEMBRANE LINING. BASE MATERIAL SHALL BE FREE FROMANGULAR ROCKS, ROOTS, GRASS, AND VEGETATION. FOREIGN MATERIALS AND PROTRUSIONS SHALL BEREMOVED AND ALL CRACKS AND VOIDS SHALL BE FILLED AND THE SURFACE MADE LEVEL OR UNIFORMLY SLOPINGAS INDICATED ON THESE DRAWINGS. THE PREPARED SURFACE SHALL BE FREE OF LOOSE EARTH, ROCKS,RUBBLE, AND OTHER FOREIGN MATTER. THE SUBGRADE SHALL BE UNIFORMLY COMPACTED TO ENSURE AGAINSTSETTLEMENT. THE SURFACE ON WHICH THE LINING IS TO BE PLACED SHALL BE MAINTAINED IN A FIRM, CLEAN,DRY, AND SMOOTH CONDITION DURING LINING INSTALLATION.6. 300mm (12") SELECT SOIL COVER: A COVER OF NATIVE SELECT SOILS 300mm (12") MINIMUM THICKNESS SHALL BEPLACED OVER THE LINER IN THOSE AREAS SHOWN ON THESE PLANS. THE SELECT SOIL COVER SHALL BESTOCKPILED WHERE INDICATED ON THE LAKE EDGE DETAIL ON IN AREAS APPROVED BY THE OWNER'SREPRESENTATIVE. THE SOIL SHALL BE PLACED OVER THE LINER IN SUCH A MANNER AS TO ENSURE THATPUNCTURES SHALL NOT OCCUR. IF EQUIPMENT DOES PUNCTURE THE LINER MATERIAL, THE COVER INSTALLATIONSHALL STOP AND REPAIRS TO THE LINER SHALL BE MADE IN ACCORDANCE WITH THE LINER SUPPLIER'SREQUIREMENTS. THE SOIL COVER MATERIAL SHALL BE FREE OF ANGULAR ROCKS, ROOTS, GRASS, ANDVEGETATION. FOREIGN MATERIALS SHALL BE REMOVED FROM THE SOIL COVER MATERIAL PRIOR TOINSTALLATION OF THE MEMBRANE LINER. SEE MANUFACTURER'S GUIDE SPECIFICATIONS FOR MOREINFORMATION.7. CONCRETE VENEER COVER (shown as shaded on the plan views): A WIRE REINFORCED CONCRETE VENEER COVERSHALL BE INSTALLED OVER THE MEMBRANE LINER BY THE LAKE CONTRACTOR WHERE SHOWN ON THESE PLANS.THE CONCRETE VENEER SHALL CONSIST OF A MINIMUM 6 SACK MIX TYPE 1 OR 2 PORTLAND CEMENT WITH AMAXIMUM AGGREGATE SIZE OF 10mm (3/8"). THE CONCRETE SHALL OBTAIN A 28-DAY COMPRESSIVE STRENGTHOF 2500 P.S.I. WHEN PREPARED IN ACCORDANCE WITH A.S.T.M. C31 TEST METHOD 231. CONCRETE FAILING TOMEET THIS SPECIFICATION SHALL BE REMOVED AND REPLACED. A 25mm x 25mm x 20 GAUGE (1" x 1" x 20 ga.)OCTAGONAL WIRE MESH SHALL BE PLACED OVER THE MEMBRANE LINER IN ALL AREAS TO RECEIVE A CONCRETEVENEER. THE WIRE SHALL BE LAID IN A CONTINUOUS LAYER WITH ADJACENT EDGES OVERLAPPING 50mm (2")MINIMUM AND SECURED TO ONE ANOTHER BY THE USE OF HOG RINGS OR OTHER APPROPRIATE CLIPS WHICHCANNOT PUNCTURE THE LINER. THE CONCRETE SHALL BE PLACED OVER THE WIRE. ALL WIRE SHALL BECOVERED WITH CONCRETE SUCH THAT NO WIRE IS VISIBLE ON THE SURFACE OR EDGE OF THE CONCRETEEXCEPT WHERE INDICATED ON THESE PLANS. THE CONCRETE SHALL BE ROUGH BROOM FINISHED AND WATEROR MEMBRANE CURED TO PREVENT EXCESSIVE CRACKING OR CHECKING. NO EXPANSION JOINTS WILL BEREQUIRED. THE CONCRETE VENEER IS EXPECTED TO CRACK DURING AND AFTER CURING. CRACKS 6mm (1/4")AND LARGER SHALL BE CAULKED.8. DECORATIVE SHORELINE TREATMENT: AN ARTIFICIAL SHORELINE SHALL BE CONSTRUCTED THAT HAS THEAPPEARANCE OF A NATURAL LAKE SHORELINE EDGE AROUND THE LAKE PERIMETER AS INDICATED ON THESEPLANS. PRIOR TO GENERAL SHORELINE INSTALLATION, THE LAKE CONTRACTOR SHALL INSTALL A 3m (10') LONGSHORELINE TEST SECTION FOR APPROVAL BY THE OWNER'S REPRESENTATIVE OF TEXTURE AND COLOR. THEARTISTIC RESULT OF THE SHORELINE TREATMENT SHALL REST WITH THE LAKE CONTRACTOR'S ABILITY TOPERFORM THIS WORK TO THE SATISFACTION OF THE OWNER'S REPRESENTATIVE AND IN ACCORDANCE WITH THEPRE-APPROVED TEST SECTION.9. CONSTRUCTION ACCESS: THE LAKE CONTRACTOR AND THE OWNER'S REPRESENTATIVE SHALL REVIEW THE SITEPRIOR TO CONSTRUCTION TO ESTABLISH AN ACCESS ROUTE IN AND OUT OF THE LAKE CONSTRUCTION AREA. THECONTRACTOR SHALL PROVIDE STAKES OUTLINING THE ACCESS ROUTE AND SHALL AT ALL TIMES KEEPCONSTRUCTION EQUIPMENT, PERSONNEL, AND VEHICLES WITHIN THE LIMITS OF THIS ROUTE. REPAIRS TO THESEFACILITIES WITHIN THE LIMITS OF THE CONSTRUCTION ACCESS ROUTE SHALL BE MADE BY THE OWNER'SREPRESENTATIVE. ALL REPAIRS OUTSIDE THESE LIMITS SHALL BE THE RESPONSIBILITY OF THE LAKECONTRACTOR.10. LAKE GRADING:A. ALL WORK SHALL CONFORM TO THE LATEST ADOPTED EDITION OF THE INTERNATIONAL BUILDING CODE (I.B.C.)AND ALL LOCAL CODES AND ORDINANCES. AN EFFORT HAS BEEN MADE TO DEFINE THE LOCATION OFUNDERGROUND FACILITIES WITHIN THE WORK AREA (THESE PLANS AND THE PLANS OF OTHER DISCIPLINES ONTHIS PROJECT). THE LAKE CONTRACTOR SHALL ASSUME SOLE AND COMPLETE RESPONSIBILITY FOR LOCATION,OR HAVING LOCATED, ALL UNDERGROUND UTILITIES AND RELATED FACILITIES AND FOR PROTECTING SAMEDURING THE COURSE OF CONSTRUCTION.B. ALL AREAS TO RECEIVE FILL SHALL BE CLEARED OF ALL BRUSH AND OTHER OBJECTIONABLE DEBRIS,INCLUDING EXISTING SOD AND OTHER ORGANIC MATERIALS, SCARIFIED TO A DEPTH OF 300mm (12") ANDWATERED AND COMPACTED TO 85% RELATIVE DENSITY IN LAKE AREAS PER THE REQUIREMENTS OF A.S.T.M.DESIGNATION D-1557-65T, OR AS APPROVED BY THE LAKE ENGINEER. THE FILL MATERIAL SHALL BE PLACED INCOMPACTED LAYERS AS SHOWN ON THE LAKE EDGE DETAILS AND FILLED AND COMPACTED AT OPTIMUMMOISTURE CONTENT BY AN APPROVED METHOD. THIS PROCEDURE SHALL APPLY ONLY FOR THE LAKE SHORELINEFILLS ON THIS PROJECT AND IS NOT INTENDED FOR BUILDING, BRIDGES, OR OTHER STRUCTURES.C. ALL UNSUITABLE SOIL, ORGANIC MATERIALS, ASPHALT, CONCRETE RUBBISH, DEBRIS, ETC. RESULTING FROMGRADING OR DEMOLITION OPERATIONS SHALL BE REMOVED FROM THE JOB SITE, TRANSPORTED TO A SUITABLELOCATION AND DISPOSED OF IN ACCORDANCE WITH APPLICABLE REGULATIONS.D. THE LAKE CONTRACTOR SHALL EMPLOY ALL LABOR, EQUIPMENT, AND METHODS REQUIRED TO PREVENT HISOPERATIONS FROM PRODUCING DUST IN AMOUNTS DAMAGING TO PROPERTY, CULTIVATED VEGETATION, ANDDOMESTIC ANIMALS OR CAUSING A NUISANCE TO PERSONS OCCUPYING BUILDINGS IN THE VICINITY OF THEJOBSITE. THE LAKE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY DAMAGE CAUSED BY THE DUST RESULTINGFROM HIS OPERATIONS. DUST ABATEMENT MEASURES SHALL BE CONTINUED UNTIL AFTER THE COMPLETION OFTHE LAKE CONTRACTOR'S WORK.E. THE LAKE CONTRACTOR SHALL ASSUME SOLE AND COMPLETE RESPONSIBILITY FOR PROTECTION OF PUBLICAND PRIVATE PROPERTY ADJACENT TO THE SITE AND THAT HE SHALL, AT HIS EXPENSE, REPAIR OR REPLACE TOORIGINAL CONDITION, ALL EXISTING IMPROVEMENTS WITHIN OR REMOVED AS A RESULT OF HIS OPERATIONS.F. THE LAKE CONTRACTOR SHALL MAINTAIN CURRENT, COMPLETE, AND ACCURATE RECORD OF ALL CHANGESWHICH DEVIATE FROM THE CONSTRUCTION AS PROPOSED BY THESE PLANS FOR THE PURPOSE OF PROVIDINGTHE LAKE ENGINEER WITH A BASIS FOR RECORD DRAWINGS. NO CHANGES SHALL BE MADE WITHOUT PRIORAPPROVAL OF THE OWNER'S REPRESENTATIVE AND THE LAKE ENGINEER. IN THE EVENT THAT THE LAKECONTRACTOR NOTICES IRREGULARITIES IN THE LINE OR GRADE, HE SHALL BRING IT TO THE IMMEDIATEATTENTION OF THE LAKE ENGINEER AND THE OWNER'S REPRESENTATIVE FOR A PROPER RESOLUTION. IF HEFAILS TO DO SO, THE LAKE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY ERROR IN THE GRADE AND THENECESSARY RECONSTRUCTION TO CORRECT SUCH ERROR.G. THE LAKE CONTRACTOR AGREES THAT, IN ACCORDANCE WITH GENERALLY ACCEPTED CONSTRUCTIONPRACTICES, THE LAKE CONTRACTOR SHALL BE REQUIRED TO ASSUME SOLE AND COMPLETE RESPONSIBILITY FORTHE CONDITION OF THE JOB SITE LAKE AREA DURING THE COURSE OF CONSTRUCTION FOR THE PROJECTINCLUDING THE SAFETY OF ALL PERSONS AND PROPERTY AND THAT THIS REQUIREMENT SHALL BE MADE TOAPPLY CONTINUOUSLY AND NOT BE LIMITED TO NORMAL WORKING HOURS.H. NEITHER THE OWNER, NOR THE LAKE ENGINEER, WILL ENFORCE SAFETY MEASURES FOR REGULATIONS ASTHEY PERTAIN TO THE LAKE CONTRACTOR, THE LAKE CONTRACTOR SHALL DESIGN, CONSTRUCT AND MAINTAINALL SAFETY DEVICES, INCLUDING SHORING AND SHALL BE SOLELY RESPONSIBLE FOR CONFORMING TO ALL LOCALSTATE AND FEDERAL SAFETY AND HEALTH STANDARDS, LAWS, AND REGULATIONS. THE LAKE CONTRACTORSHALL PROVIDE TO THE OWNER, PRIOR TO THE START OF WORK, WORKER'S COMPENSATION INSURANCE,PRODUCTS AND COMPLETED OPERATIONS AND COMPREHENSIVE LIABILITY INSURANCE CERTIFICATES.11. LAKE RECIRCULATION SYSTEM AND AERATION SYSTEM PIPING:ALL PIPE SHOWN ON THESE PLANS SHALL BE P.V.C. (POLYVINYL CHLORIDE) OR HDPE (HIGH DENSITYPOLYETHYLENE) PIPE UNLESS OTHERWISE NOTED AND SHALL CONFORM TO THE FOLLOWING SCHEDULE:PVC:HDPE:PIPES 100mm (4") dia. AND SMALLER:SCHEDULE 40 (I.P.S.)DR 11PIPES 150mm (6") dia. AND 200mm (8") dia:CLASS 160 (I.P.S.)DR 11PIPES 250mm (10") dia. TO 900mm (36") dia:100 psi (P.I.P.)DR 13.5Important!! IF HDPE IS USED ENSURE THAT THE INSIDE DIAMETER OF THE PIPE MATCHES WHAT IS SHOWN ONTHE PLAN.12. ALL LAKE RECIRCULATION SYSTEM PIPING SHALL BE INSTALLED SO THE FLOW IS LEVEL OR UPHILL TO PREVENTAIR TRAPS AND SHALL BE A MINIMUM 900mm (3'-0") COVER OUTSIDE THE LAKE LIMITS AND 300mm (1'-0") MINIMUMCOVER WITHIN LAKE LIMITS UNLESS OTHERWISE NOTED ON THESE PLANS. THE LAKE CONTRACTOR SHALLSUBMIT MANUFACTURER'S PRODUCT DATA SHEETS WHICH INDICATE PIPE WALL THICKNESS AND JOINT TYPES TOTHE LAKE ENGINEER FOR APPROVAL PRIOR TO ORDERING PIPE MATERIAL.Lake 16 Data:WATER SURFACE AREA (SF): 23,630SHORELINE LENGTH (LF): 811LAKE VOLUME (GALLONS): 723,340(2.22 ac-ft)Lake 11 Data:WATER SURFACE AREA (SF): 36,620SHORELINE LENGTH (LF): 1,060LAKE VOLUME (GALLONS): 1,564,000(4.80 ac-ft)La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CANOT FORCONSTRUCTION03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 720 37537036536536036035535535034515' TA L L W R O U G H T I R O N F E N C E EX 5' TALL WROUGHT IRON FENCEEX 5' TALL CHAINLINK FENCE (BLACK)NLINK FENCEMatchline - see sheetMatchline - see sheetLK3.1ALAIDBACKSHORELK3.1ALAIDBACKSHORELK3.1ALAIDBACKSHORELK3.1ALAIDBACKSHORELake#1653.045.04: 1 45464748495051524:14 5 4 6 4 7 4 8 4 9 5 0 5 1 5 2 4:1 5251504948474645LK3.2APLANTERSHORELK3.2APLANTERSHORELK3.2APLANTERSHORELK3.2APLANTERSHORELK3.2APLANTERSHORE(BIOBOOST)(BIOBOOST)(BIOBOOST)(BIOBOOST)LK3.4ATROUGH6'-0"6'-0"10'-0"10'-0"LK3.4D50'CUT-OFFWALLBOULDERPOCKET ASSHOWN PERDETAIL(TYPICAL WHEREROCK IS SHOWNAT SHORELINE)BLK3.2BOULDERPOCKET ASSHOWN PERDETAIL(TYPICAL WHEREROCK IS SHOWNAT SHORELINE)BLK3.2SEAL RECIRC. INTAKEPIPE TO LAKE LINERAS SHOWN PERDETAILLK6.1A346.50INV. EL.INTAKE PIPEINTAKE PIPE SCREENPER DETAILLK6.1BVVVVLK3.4ATROUGH(2) 1"2"dia. AERATION PIPE18"dia. INTAKE PIPE8"dia. TRANSFER PIPE2"dia. AERATION PIPE(2 ) 1 "8"dia. TRANSFER PIPEAeration SystemCabinets:PROVIDE (2) AERATION SYSTEMCABINET, EACH WITH (2)COMPRESSORS PER DETAILTHE CABINETS SHALL BEINSTALLED ON THE PUMPSTATION SLABLK4.1A / BTRANSFER PUMP STATIONAS SHOWN PER DETAILT.O. WET WELL EL. 360.20INTK PIPE I.E. 345.50WELL F.F.E. 343.75LK5.1ABLK2.1ALK2.1lc2-1/2"dia.LAKE FILLPOINT OFCONNECTIONTO IRRIGATIONMAIN LINEMECHANICAL LEVELCONTROL AS SHOWNPER DETAILLK3.6BLK3.4ATROUGH6'-0"6' -0 "SEAL LINER TOOVERFLOWSTRUCTURE ASSHOWN PER DETAIL- SEE CIVIL PLANSFOR MORE INFOLK3.3ALK3.4ATROUGH6'-0"6'-0"NEW WELL FILL TRANSFER PIPE BY OTHERSN EW W E L L F I L L T R A N S F E R P I P E B Y O T H E R SNEW WELL FILL TRANSFERPIPE BY OTHERSNOTE:FOR TYPICAL LAKEFILL REQUIREMENTSSEE DETAILWHEREOCCURS IN THEFIELDLK3.6ALK3.3ANOTE:WEST SIDE OF LAKEHAS (2) FAIRWAY /GREEN DRAIN PIPES- VERIFY PIPEQUANTITY ANDLOCATIONS IN THEFIELD - CONNECT TOEXISTING DRAIN PIPE6" ABOVE THE FINISHFREEBOARD OF THELAKE AND RUN SOLIDWALL PIPE WITHSOLVENT WELDFITTINGS THRU LAKELINER WITH PIPEBOOT AS SHOWN PERRUN WELL FILL OVERSHORELINE AS SHOWNPER DETAILCONCEALWITH ROCKLK3.4BRUN WELL FILL OVERSHORELINE AS SHOWNPER DETAILCONCEALWITH ROCKLK3.4BNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHDASHED LINEINDICATES EXISTINGLAKE LIMITSSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comPlans for Resubmit 05-14-20251LK1.1Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2B105-23-25 PER TOWN COMMENTS22Page 721 37538038038538539012EX 5' TALL WOOD FENCEEX 5' TALL CHAINLINK FENCE (BLACK)Matchline - see sheetMatchline - see sheet 8"dia. TRANSFER PIPEMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheet8"dia. TRANSFER PIPENEW WELL FILL TRANSFER PIPE BY OTHERSNEW WELL FILL TRANSFER PIPE BY OTHERSNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.2Lake System Plan View LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2B0'20'30'40'NORTHScale: 1" = 20'La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 722 3753703803851212EX 5' TALL CHAINLINK FENCE (BLACK)Matchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheet8"dia. TRANSFER PIPE8"dia. TRANSFER PIPE8"dia. TRANSFER PIPENEW WELL FILL TRANSFER PIPE BY OTHERSNEW WELL FILL TRANSFER PIPE BY OTHERSNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.3Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2BLa Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 723 350380380380375370365365355360360EX 5' TALL RETAINING WALL BLOCK WITH 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEEX 5' TALL WROUGHT IRON FENCEMatchline - see sheetMatchline - see sheetMatchline - see sheetMatchline - see sheet8"dia. TRANSFER PIPE8"dia. TRANSFER PIPENEW WELL F ILL TRANSFER P IPE BY OTHERSNEW WELL FILL TRANSFER PIPE BY OTHERSNOTE:SEE IRRIGATIONDESIGNER'S PLANSFOR FINAL ROUTINGOF WELL FILL LINE.LINE SHOWN HEREFORDIAGRAMMATICALPURPOSES ONLYAND IS FOLLOWINGTHE TRANSFER LINEASSUMING THERE ISAN OPPORTUNITY TOSHARE A TRENCHSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLK1.4Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2BLa Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 724 350350355360365370375350375380380380696710119ELECEX 5' TALL WROUGHT IRON FENCEEXISTING BRIDGELakeFillLakeFillLakeFillMatchline - see sheetMatchline - see sheetLK3.5B2PLANTERSHORELK3.2ALK3.1ALAIDBACKSHOREPLANTERATEXISTINGSHORELINELK3.5B1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5B2PLANTERATEXISTINGSHORELINELK3.5B1LK3.5B2PLANTERATEXISTINGSHORELINELK3.5B1LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1LK3.5B2PLANTERATEXISTINGSHORELINELK3.5B1LK3.1ALAIDBACKSHORELK3.2APLANTERSHORELK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1PLANTERATEXISTINGSHORELINELK3.5B1LK3.5B2LK3.5A3SHORELINEMODIFICATIONSTO EXISTINGSHORELINELK3.5A2LK3.5A1BOULDERPOCKET ASSHOWN PERDETAIL(TYPICAL WHEREROCK IS SHOWNAT SHORELINE)BLK3.2EXISTING OVERFLOWTO REMAIN AS IS - DONOT DISTURBLK6.1PROVIDE 36" WIDESECTION OFEXISTING LINER TOATTACH NEW LINERAS SHOWN PERDETAILCCUT EXISTINGRETAINING WALL ANDFOOTING TO REVEALEXISTING LINER TOSEAM TO - DO NOTDAMAGE EXISTINGLINEREXISTING STORM FLOW ENTRY STRUCTURETO REMAIN AS IS - DO NOT DISTURBEXISTING IRRIGATIONSTATION TO REMAIN -INSTALL ADDITIONALAERATION CABINETINSIDE BUILDING TOPROVIDE ADDITIONALAERATIONAeration SystemCabinets:PROVIDE (1) AERATION SYSTEMCABINET, EACH WITH (2)COMPRESSORS PER DETAILTHE CABINETS SHALL BEINSTALLED ON THE INSIDEEXISTING IRRIGATION BUILDINGNEXT TO EXISTING AERATIONCABINET - FIELD LOCATEEXISTING AERATION VALVESAND RUN NEW 2"dia. AERATIONPIPE TO EXISTING VALVELOCATIONLK4.1A / BLK3.6PROVIDE 36" WIDESECTION OFEXISTING LINER TOATTACH NEW LINERAS SHOWN PERDETAILBCUT EXISTINGRETAINING WALL ANDFOOTING TO REVEALEXISTING LINER TOSEAM TO - DO NOTDAMAGE EXISTINGLINER4:146.545.544.543.542.541.540.539.53:1Lake#1147.539.5LK6.1CSEALTOEXISTINGLINER(BIOBOOST)(BIOBOOST)(BIOBOOST)(BIOBOOST)(EXISTING)(VERIFY)(EXISTING)(VERIFY)(EXISTING)(VERIFY)(NEW)39.540.541.542.543.544.545.546.53:1 39. 5 40. 5 41. 5 42. 5 43. 5 44. 5 45. 5 46. 5 3:139. 5 40. 5 41. 5 42. 5 43. 5 44. 5 45. 5 46. 53:146.545.544.543.542.541.540.539.53:146.545.544.543.542.541.540.539.5 3:1EXISTINGIRRIGATIONINTAKE PIPEVV(2)1"NOTE:WEST SIDE OF LAKEHAS (3) DISCHARGEPIPES WITHISOLATION VALVES INEXISTINGWATERFALLSTRUCTURES -VERIFY PIPELOCATIONS IN THEFIELD AND DEMOEXISTINGWATERFALLSTRUCTURES - RUNPIPE OVER LINERWITH 6" AIR GAP ANDCONCEAL WITH ROCK/ PLANTING2"8"dia. TRANSFER PIPE6' - 0 "6'-0"LK3.4ATROUGH6'-0"6'- 0 "LK3.4ATROUGHLK3.5B2PLANTERATEXISTINGSHORELINELK3.5B16'-0"6'- 0 "LK3.4ATROUGH6'-0"6'-0"LK3.4ATROUGHE X I S T I N G W E L L F I L L ( F I E L D V E R I F Y L I N E S I Z E ) EXISTING W E L L F I L L ( F I E L D V E R I F Y L I N E S I Z E ) N E W W E L L F I L L T R A N S F E R P I P E B Y O T H E R SNEW WELL FILL TRANSFER P IPE BY OTHERSNOTE:FOR TYPICAL LAKEFILL REQUIREMENTSSEE DETAILWHEREOCCURS IN THEFIELDLK3.6AEXISTING BRIDGE TOREMAIN - DO NOT DISTURBPLANTERATEXISTINGSHORELINELK3.5B1LK3.5B2LK3.3ANOTE:WEST SIDE OF LAKEHAS (3) FAIRWAY /GREEN DRAIN PIPES- VERIFY PIPEQUANTITY ANDLOCATIONS IN THEFIELD - CONNECT TOEXISTING DRAIN PIPE6" ABOVE THE FINISHFREEBOARD OF THELAKE AND RUN SOLIDWALL PIPE WITHSOLVENT WELDFITTINGS THRU LAKELINER WITH PIPEBOOT AS SHOWN PERDASHED LINEINDICATES EXISTINGLAKE LIMITSSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comPlans for Resubmit 05-14-20251LK1.5Lake System Plan View0'20'30'40'NORTHScale: 1" = 20'LEGENDF.S.X.XXT.W.T.F.I.E.X.XXX.XXX.XXXXXXVXX dia.XX dia.Alternate:AS AN ALTERNATE TO THISDISK, THE CONTRACTOR SHALLBID THE "BIO-BOOST" DIFFUSERSHOWN ON DETAILLK4.2BINDICATES POINTOF CONNECTION TOSITE UTILITIES ASSHOWN ON PLAN= DETAIL NUMBER= SHEET NUMBER= WATER SURF. EL.= FINISH BOTTOM(LINER) ELEVATION= TOP OF WALL EL.= FINISH SURF. EL.= PIPE INVERT EL.= T.O. FOOTING EL.THIS SYMBOLWHERE SHOWN ONPLAN INDICATESSHORE TYPETRANSITION ANDLIMITS OF EACHTYPE OF SHORERECIRCULATIONPIPE - FOR TRENCHREQMTS SEEFOR THRUSTBLOCKS SEELK4.2DLK4.2CAERATION PIPE -FOR TRENCHREQMTS SEELK4.2DAERATION VALVE INVLV BOX PERLK4.2AAERATIONDIFFUSER DISKWITH WEIGHTEDHOSE LAID ON LAKEBOTTOM PERLK4.2B105-23-25 PER TOWN COMMENTS05-23-25 PER TOWN COMMENTS22Page 725 +5+0+25+20+15+10-5-10-15+25+20+15+10+5+0-5-10-15-20-20LAKE - WIDTH VARIES PER PLAN4 (MIN.)1DEPTH PER PLAN4 (MIN.)1LAKE SHORELINESHOWN ON PLAN CONCRETE SHELF(WIDTH VARIES PERSHORE DETAIL)LAKE SHORELINE SHOWN ON PLAN CONCRETE SHELF(WIDTH VARIES PERSHORE DETAIL)A"LAID BACK" SHORELINETREATMENT PER DETAIL .LK3.1.12" THICK SELECT SOIL LINERCOVER PER GENERAL NOTESLAKE GEOMEMBRANE LINERPER GENERAL NOTESCAREFULLY PREPARED LINERSUBGRADE PER GENERAL NOTES- TYPICAL THRU-OUT LIMITS OFLAKE GEOMEMBRANE LINERA"LAID BACK" SHORELINETREATMENT PER DETAIL .LK3.1LAKEWATERSURFACEEL. PERPLANLAKELINERELEVATIONPER PLANLAKEWATERSURFACEEL. PERPLANLAKELINERELEVATIONPERPLANALTERNATE BID ITEM8oz GEOTEXTILE FABRIC BENEATHGEOMEMBRANE LINER PER GENERALNOTES (TYPICAL) SHOWN AS DASHED LINEALTERNATE BID ITEM6" THICK (MINIMUM) APPROVED PLATINGMATERIAL BY GRADING CONTRACTOR - SEEGENERAL NOTES FOR ALLOWABLE SOIL TO BEUSED BENEATH GEOMEMBRANE LINER+5+0+25+20+15+10-5-10-15+25+20+15+10+5+0-5-10-15LAKE WATERSURFACE EL.P E R P L A NLAKE LINERE L E V A T I O NP E R P L A NLAKE WATERSURFACE EL.P E R P L A NLAKE LINERE L E V A T I O NP E R P L A N-20-20LAKE - WIDTH VARIES PER PLAN4 (MIN.)1DEPTH PER PLAN4 (MIN.)1LAKE SHORELINESHOWN ON PLAN PLANTER POCKET(WIDTH VARIES PERSHORE DETAIL)LAKE SHORELINE SHOWN ON PLAN .12" THICK SELECT SOIL LINER COVER PERGENERAL NOTESLAKE GEOMEMBRANE LINER PERGENERAL NOTESCAREFULLY PREPARED LINER SUBGRADEPER GENERAL NOTES - TYPICALTHRU-OUT LIMITS OF LAKEGEOMEMBRANE LINERA"LAID BACK" PLANTERSHORELINE TREATMENT ASSHOWN PER DETAILLK3.2A"LAID BACK" PLANTERSHORELINE TREATMENT ASSHOWN PER DETAILLK3.2PLANTER POCKET(WIDTH VARIES PERSHORE DETAIL)ALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.1SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.com3/16" = 1'-0"SCALE:SCALE:3/16" = 1'-0"La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA05-23-25 PER TOWN COMMENTS2Page 726 -9 -10 -5 -8 -7 -6 -3 -4 +3 -2 -1 +0 +1 +2 +8 +7 +6 +5 +4 -9 -10 -5 -8 -7 -6 -3 -4 +3 -2 -1 +0 +1 +2 +8 +7 +6 +5 +4 -11 -9 -10 -5 -8 -7 -6 -3 -4 +3 -2 -1 +0 +1 +2 +8 +7 +6 +5 +4 -9 -10 -5 -8 -7 -6 -3 -4 +3 -2 -1 +0 +1 +2 +8 +7 +6 +5 +4 -11 DEPTH AS SHOWN ON PLAN5'-0" 1'-0" OVERLAP 6'-0" 1 PER SECTION LAKE SYSTEM MEMBRANE LINER AS CALLED OUT IN GENERAL NOTES - INSTALL PER THE REQUIREMENTS OF THESE PLANS AND THE LINER MANUFACTURER 12" MINIMUM THICK SELECT SOIL COVER OVER THE LAKE SYSTEM MEMBRANE LINER - THE SOIL COVER MATERIAL SHALL CONFORM TO THE REQUIREMENTS OF THE LAKE SYSTEM GENERAL NOTES AND THE LINER MFR'S REQMENTS (TYP. THRU-OUT) CAREFULLY PREPARED LINER SUBGRADE PER THE REQUIREMENTS OF THE LAKE SYSTEM GENERAL NOTES - TYPICAL THROUGHOUT LAKE BOTTOM & SHORE SURFACESLAKESHORELINESHOWN ON PLANLAKE LIMITS SHOWN ON PLAN NOTE: REFER TO DETAILS BELOW FOR TYPICAL LAKE SHORE ROUGH GRADING, SHORE SHAPING AND LAKE EDGE FINISH GRADING REQUIREMENTS. ALSO... REFER TO LAKE CROSS SECTIONS FOR LAKE BOTTOM SLOPES WATER SURFACE EL. PER PLAN L A K E F I N I S H BOTTOM EL. PER P L A N Liner Cover Note: WHERE THE LAKE / POND BOTTOM IS SHOWN SHADED ON THE PLAN VIEW, SUBSTITUTE THE EARTH COVER OVER THE MEMBRANE LINER WITH 3" MIN. THICK CONCRETE VENEER REINFORCED WITH 1" x 1" x 20ga OCTAGONAL WIRE MESH OVER THE MEMBRANE LINER TO THE LIMITS OF THE SHADED AREA SHOWN ON THE PLAN VIEW (TYPICAL). Note: THE LAKE / POND EDGE GRADES SHOWN HERE ARE DIAGRAMMATIC - THE FINAL SHAPING TO TIE INTO ADJACENT LANDSCAPE AREA GRADES SHALL BE PREFORMED BY THE LAKE / POND CONTRACTOR IN THE FIELD UNDER THE DIRECTION OF THE OWNER'S REPRESENTATIVE Earth Cover Note: EXCAVATE THE LAKES / PONDS TO THE LINER ELEVATION SHOWN ON THESE PLANS. EARTH COVER MATERIAL SHALL BE GENERATED FROM EXISTING BOTTOM SOILS IN SUFFICIENT QUANTITY TO COVER ALL LINER SURFACES SHOWN ON THESE DRAWINGS WHERE CONCRETE VENEER DOES NOT OCCUR. THE MATERIAL SHALL BE SUITABLE FOR LINER COVER AS DESCRIBED IN THE LAKE / POND SYSTEM GENERAL NOTES AND SHALL BE STOCKPILED ON THE LAKE / POND BOTTOM. THE LAKE / POND CONTRACTOR SHALL PICKUP AND MOVE THE MATERIAL TO WITHIN THE LAKE / POND AND SHALL APPLY IT OVER THE LINER AS REQUIRED BY THESE PLANS AND BY THOSE MEANS NECESSARY TO ENSURE THAT THE LINER IS NOT DAMAGED DURING THE LINER COVER INSTALLATION PROCESS. IMPORTANT!! PRIOR TO COVER INSTALLATION, THE LAKE / POND CONTRACTOR SHALL DETERMINE IF THE MATERIAL MEETS THE REQUIREMENTS OF THE GENERAL NOTES AND THE LINER MANUFACTURER'S RECOMMENDATIONS FOR COVER MATERIAL. IF IT DOES NOT MEET THIS REQUIREMENT, ANOTHER SOURCE OF MATERIAL SHALL BE PROVIDED BY THE OWNER, AND THE LAKE / POND ENGINEER SHALL BE NOTIFIED IMMEDIATELY. TYPICAL SECTION thru LAKE SCALE: 1/4" = 1'-0" "Spoils" Treatment Notes... 1. THE "SPOILS" MATERIAL DEPICTED ON THIS DETAIL AND ELSEWHERE IN THESE PLANS, SHALL CONSIST OF APPROXIMATELY 75% FINES TO 1"dia. AND 25% 1"dia. TO 3" dia. COBBLES. THE SPOILS MATERIAL SHALL BE MIXED TOGETHER TO PRODUCE A GRANULAR SOIL AND GRAVEL POND BOTTOM SURFACE TO THE LIMITS SHOWN. THE GRAVEL MATERIAL AND SOIL MIXTURE (REFERRED TO AS "SPOILS" ON THESE PLANS) SHALL BE APPROVED FOR COLOR, MIX, AND APPEARANCE BY THE LAKE / POND ENGINEER PRIOR TO PLACEMENT IN THE SHORE TREATMENT. IF THE MATERIAL WHICH MEETS THESE REQUIREMENTS IS FOUND TO EXIST ON SITE, THE LAKE / POND ENGINEER MAY APPROVE THEIR USAGE FOR THIS APPLICATION. 2. PLACEMENT OF THE "SPOILS" MATERIAL SHALL OCCUR IMMEDIATELY AFTER THE CONCRETE VENEER IS PLACED AND IS STILL WET. THE VENEER SHALL HAVE A FLOATED SURFACE TEXTURE. IMMEDIATELY AFTER THE CONCRETE VENEER IS PLACED AND BEFORE IT HAS BEGUN TO SETUP, THE CREW SHALL APPLY THE "SPOILS" MATERIAL BY BROADCASTING BY SHOVEL THE MATERIAL IN A THIN LAYER (AS NOTED ON THE DETAIL) DIRECTLY ATOP THE CONCRETE SURFACE SUCH THAT IT IS COMPLETELY COVERED. ALTERNATE BID ITEM 6" THICK (MINIMUM) APPROVED PLATING MATERIAL BY GRADING CONTRACTOR - SEE GENERAL NOTES FOR ALLOWABLE SOIL TO BE USED BENEATH GEOMEMBRANE LINER ALTERNATEBID ITEMS FOR ALTERNATE BID ITEMS SEE DETAIL ALK2.1 6'-0" APPROXIMATELY 5'-0" 1'-0" LIMITS OF LAKE EDGE SHOWN ON PLAN 6"LAKEWATERSURFACEELEVATIONPER PLAN FREEBOARDELEV. PERSHORE DET'L 1'-6"1'-0" (MIN)LAKE EDGESHOWN ON PLAN(OVERLAP) LIMITS OF 3" THICK CONCRETE VENEER 1'-0"(VARIES) 1 "SPOILS"THICKNESSVARIES 2"(MIN.) TO 4"1 (PER SECTION) COVER WET CONCRETE VENEER WITH "SPOILS" AS CALLED OUT IN "SPOILS" NOTE ON THIS SHEET LAKE SYSTEM MEMBRANE LINER THRU-OUT LIMITS OF LAKE AS CALLED OUT IN LAKE SYSTEM GENERAL NOTES ROCKS AND COBBLES 6"dia. TO 3"dia. LOCATED INTERMITTENTLY ALONG SPOILS TREATMENT IS ALLOWED 3" THICK CONCRETE VENEER REINF. WITH 1" x 1" x 20ga. OCTAGONAL WIRE MESH THRU-OUT 12" THICK SELECT SOIL COVER OVER MEMBRANE LINER TO LIMITS SHOWN ON PLAN VIEW ENLARGED LAKE EDGE DETAIL NO SCALE FILL THIS SPACE WITH 3/4" GRAVEL OR C R U S H E D R O C K ( C O N T I N U O U S ) 5'-0"6'-0" 1 PER SECTION 1 1 TO FIT 1 FITTO 6"6"1'-0"5'-0"6'-0"SHOWN ON PLAN LAKE LIMITS 5'-0"6'-0"5'-0"6'-0"LAKE SHOREPER PLANROUGH GRADE THE LAKE BASINS TO THIS LIMIT +/- 6" WHERE SHOWN ON THE LAKE PLAN VIEW - THE FINISH SURFACE SHALL BE FREE FROM DEBRIS AND ROCKS LARGER THAN 6"dia. AND SHALL BE GRADED AS SHOWN ON THE LAKE PLAN VIEW (UNLESS OTHERWISE NOTED) SLOPE VARIES PER GRADING PLAN THE LAKE CONTRACTOR SHALL INCLUDE AS A PART OF HIS WORK, THE EXCAVATION AND SHORELINE SHAPING REQUIRED TO FIT THE SHORELINE TREATMENT SHOWN - THE EXCESS SOILS SHALL BE STOCKPILED BY THE LAKE CONTRACTOR IMMEDIATELY OUTSIDE THE LAKE SHORELINE FOR FUTURE BACKFILL OVER THE COMPLETED SHORELINE 1 PER SECTION THE LAKE CONTRACTOR SHALL PREPARE THE LINER SUBGRADE, INSTALL WIRE AND CONCRETE VENEER AND APPLY "SPOILS" TREATMENT OVER THE CONCRETE VENEER AS SHOWN ON THIS DETAIL THE LAKE CONTRACTOR SHALL COVERTHE LAKE MEMBRANE LINER WITH SELECT SOIL AS CALLED FOR IN THE GENERAL NOTES Note!! FINISH GRADING AND BACKFILLING BEYOND THAT SHOWN HERE SHALL BE BY OTHERS AND NOT A PART OF THE LAKE CONSTRUCTION WORK SHOWN ON PLAN LAKE LIMITS SHOWN ON PLAN LAKE LIMITS SHOWN ON PLAN LAKE LIMITS LAKE SHOREPER PLANLAKE SHOREPER PLANLAKE SHOREPER PLANFREEB'DEL. PERSHORE DETAIL LAKE WATER SURFACEEL. PERPLAN LAKEWATER SURF.EL. PERPLAN FREEB'D EL. PERSHORE DETAIL LAKEWATER SURFACEEL. PERPLAN FREEB'D EL. PERSHORE DETAIL LAKEWATER SURFACEEL. PERPLAN FREEB'D EL. PERSHORE DETAIL 1. Lake Rough Grading SCALE: 1/4" = 1'-0"2. Lake Shore Shaping SCALE: 1/4" = 1'-0"3. Lake Edge Treatment SCALE: 1/4" = 1'-0"4. Lake Finish Grading SCALE: 1/4" = 1'-0" THE LAKE CONTRACTOR SHALLUSE THE PREVIOUSLY EXCAVATEDAND STOCKPILED SHORELINE SOILMATERIAL TO BACKFILL OVER THELAKE SHORE TREATMENT 45° INSTALL 12" LONG 2x2 WOOD STAKES @ 3'-0" O.C. CONT. - SET TOP OF STAKE AT POND FREEBOARD ELEVATION LAY A SINGLE #2 BAR CONTINUOUS AT TOP OF STAKE AND CONNECT WITH "U" NAILS (1 ea. PER STAKE) STAKES AND #2 BAR ARE TO BE LEFT IN PLACE AFTER BACKFILL LK3.4 AS SHOWNSCALE:SHEET TITLE:SHEET NO: P2122 RAM / APM AS SHOWN DATE: REVISIONS: SCALE: PROJ. NO: DRAWN:LOS GATOS, CALIFORNIALA RINCONADA COUNTRY CLUB06-19-2024 Lake Plans for Submittal 06-19-2024Lake System Construction Drawings2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comLa Rinconada Golf Course Modernization Project17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA05-23-25 PER TOWN COMMENTS2 Page 727 LK3.41'-6"6"4'-0"PLANTER AREA VARIES 8'-0" - 12'-0" (SEE PLAN)3'-6"1'-0"3'-0" MAX. 1'-0"6"6"6"LAKE WATERSURFACE EL.P E R P L A NF R E E B O A R DE L E V A T I O NP E R P L A N1'-0"1'-0"1'-0"6"LAKE SHORELINESHOWN ON PLAN CURBSHOWN ONPLANPER SHORE DETAIL112LAKE WIDTH VARIES PER PLAN3" THICK CONCRETE VENEER OVERMEMBRANE LINER REINFORCED WITH 1" x1" x 20ga. OCT. WIRE MESH THROUGHOUTCAREFULLY PREPARED NATIVE SOIL SUBGRADE AS DESCRIBED IN THE LAKESYSTEM GENERAL NOTES THROUGHOUT THE LIMITS OF THE LAKE MEMBRANELINER SYSTEMLAKE SYSTEM MEMBRANE LINER AS CALLED OUT IN LAKE SYSTEM GENERALNOTES - INSTALL LINER PER THE REQUIREMENTS OF THESE PLANS AND THE LINERMANUFACTURERCOVER WET CONCRETE VENEER WITH"SPOILS" TREATMENT WHICH VARIESIN THICKNESS FROM 2" THICK(MINIMUM) TO 4" THICK (MAXIMUM) TOCOMPLETELY COVER THE VENEERBELOW. - SEE "SPOILS" TREATMENTNOTES ON EDGE DETAIL FOR MOREINFORMATIONUSE 6 X 8 X 16 CMU BLOCK AS FILLERCOVERED WITH ONE LAYER OF 1" X 1"X 20ga OCT. WIRE MESH CONTINUOUSSPECIAL SOIL MIX FORWATER PLANTS ASSPECIFIED BY THEPROJECT LANDSCAPEARCHITECT (IF REQUIRED)- VERIFY MIX WITHLANDSCAPE ARCH IN THEFIELDNote:AQUATIC PLANT DESIGN AND INSTALLATION BY OTHERS - VARIOUS WATERPLANTS AS SPECIFIED BY THE LANDSCAPE DESIGNER - NOT A PART OFWATER FEATURE CONSTRUCTIONCONCRETE KEY CONTINUOUSTO SIZE SHOWN (TYPICAL)FORM CURB TO SEPARATE SITE SOILSFROM PLANTER SOIL AS SHOWNCONTINUOUS - COVER WITH SPOILSBACKFILL THIS AREA TO LEVELSHOWN WITH 3/4" GRAVEL ORCRUSHED ROCK CONTINUOUSSamplePhoto"Spoils" Note:FOR MATERIALS ANDINSTALLATION OFDECORATIVE SPOILSSEE LAKE SHORELINETREATMENT DETAILS(TYPICAL)ALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.1FREEBOARDELEV. PERSHORELINEDETAILPONDWATERSURFACEEL. PERPLAN6"1'-6"LIMIT OF 4" THICK CONCRETE VENEERREINFORCED WITH (2) LAYERS OF1' x 1" x20ga. OCTAGONAL WIRE MESH2'-0"VARIES WITH ROCK SIZEPOND SYSTEM MEMBRANE LINERPER GENERAL NOTESTHROUGHOUT LIMITS OF PONDTO FREEBOARD ELEVATIONPOND BOTTOMSURFACE ANDSHORELINE FINISHSURFACE TREATMENTSHALL BE AS CALLEDOUT ON SHORELINEDETAIL (TYP.)1PER SHOREDETAILFILL ALL VOIDS SOLIDWITH CONCRETESIZE POCKET TO RECEIVESELECTED BOULDERS (6 FOOTBOULDER DIAMETER MAXIMUM)21SamplePhotoBid Note:THE LAKE CONTRACTOR SHALL PROVIDE AUNIT PRICE (PER LINEAL FOOT) AS A PART OFHIS BID FOR THIS SHORE TREATMENT. THELANDSCAPE ARCHITECT SHALL DETERMINETHE LOCATIONS AND EXTENTS OF THISTREATMENT IN THE FIELDALTERNATEBID ITEMSFOR ALTERNATE BIDITEMS SEE DETAILALK2.1SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:1" = 1'-0"SCALE:1" = 1'-0"La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 728 Liner PanelInstallationLiner PanelField SeamingPipe BootInstallationSubgradePreparationSUBGRADE SHALL BEABSOLUTELY SMOOTH - USEROLLER - COMPACTOR PER"VOLVO model SD70 vibratoryroller" OR LARGER AS REQUIREDAND HAND RAKING TO ACHIEVETHIS LEVEL OF SMOOTHNESSAND UNIFORMITY4" (MIN.) to 6" (MAX.)2" BONDWIDTH MINIMUMPIPEBOOT PIPETAC-TAPESTAINLESSSTEEL CLAMPPIPE BOOT SKIRTWELD ALL 4 SIDESPREPAREDSUBGRADEPIPE BOOTPROVIDE SLACKAT BENDEDEDGEFIELD SEAM (4)SIDESGEOMEMBRANELINERPIPE BOOT1/4" X 2" FLAT STAINLESSSTEEL , ALUMINUM ORPOLYPROPYLENE BARBUTYL TAC TAPE3/8" x 3" LG S.S. ANCHORBOLT, NUT AND WASHER12" O.C. (ABOVE WATERLEVEL) 6" O.C. (BELOWWATER LEVEL)GEOMEMBRANE LINERCONCRETE STRUCTURE1/4" X 2" FLAT STAINLESSSTEEL , ALUMINUM ORPOLYPROPYLENE BARBUTYL TAC TAPE3/8" x 3" LG S.S. ANCHORBOLT, NUT AND WASHER12" O.C. (ABOVE WATERLEVEL) 6" O.C. (BELOWWATER LEVEL)GEOMEMBRANE LINERCONCRETE STRUCTUREPREPAREDSUBGRADESEAM TO BE MADE USING HOT AIR / HOTWEDGE WELDING TECHNIQUESLOOSE EDGE MAY OCCUR ON THERMALSEAMSGEOMEMBRANELINER PERGENERALNOTESVertical SurfaceHorizontal SurfaceField Seal to Concrete StructureField Seam / Splice DetailFactory Fabricated Pipe Boot(on slope) ALL PIPE SIZESThe LAKE System Geomembrane Liner Shall be:30 mil LLDPE-R(Scrim Reinforced LLDPE)as manufactured by . . .1.0 GENERAL1.1 SCOPE OF WORK RELATED TO POND (RESERVOIR) LINER WORK.THE LINER MANUFACTURER PRODUCES REINFORCED LINEAR LOW DENSITYPOLYETHYLENE (LLDPE) GEOMEMBRANE FABRICS IN 30 AND 45 MILTHICKNESSES. THE FOLLOWING INSTALLATION INSTRUCTIONS ARE MEANTAS A MINIMUM SET OF STANDARDS THAT ARE TO BE FOLLOWED. ALL WORKSHALL BE DONE IN STRICT ACCORDANCE WITH THE POND ENGINEER'SDRAWINGS AND SPECIFICATIONS AND THE FABRICATOR'S APPROVED SHOPDRAWINGS.1.2 DESCRIPTION OF THE PRODUCTSLLDPE GEOMEMBRANE FABRICS ARE PRODUCED IN THE FABRICATOR'SFACILITY. THE GEOMEMBRANE IS REINFORCED WITH A 9 X 9, 1000 DENIERWEFT INSERTED WARP KNIT POLYESTER SCRIM. THE SCRIM HAS BEENDESIGNED FOR HIGH TENSILE AND TEAR STRENGTH. IN THE PRODUCTIONPROCESS, THE LONGITUDINAL EDGES OF THE SCRIM ARE ENCAPSULATED BYTHE COATING LAYERS.THE 30 AND 45 MIL LLDPE GEOMEMBRANE FABRICS HAVE BEEN EXTRUSIONCOATED WITH A HIGH FLEXIBILITY MATERIAL. THE COATING ALSO CONTAINSPIGMENTS AND ULTRAVIOLET (UV) INHIBITORS. THE FINISHED MEMBRANESHALL MEET OR EXCEED THE PHYSICAL PROPERTY VALUES SHOWN ON THEDATA SHEET BELOW:2.0 PRODUCTION AND HANDLING OF PANELS2.1 FACTORY FABRICATION OF PANELSGEOMEMBRANE FABRICS ARE FLEXIBLE ENOUGH TO ALLOW FOR FACTORYWELDING AND FOLDING OF PANELS FOR DELIVERY TO THE INSTALLATIONSITE. WHENEVER POSSIBLE THE USE OF FACTORY SEAMS AND LARGEPANELS SHALL BE MAXIMIZED. THE FABRICATOR SHALL PRODUCE THEPANELS WITH WELDS N THE PATTERN AND DIRECTIONS AS SHOWN ON THEPLANS AND / OR THE FABRICATOR'S APPROVED SHOP DRAWINGS.ALL FACTORY WELDS SHALL BE PRODUCED USING A THERMAL WELDINGSYSTEM SUCH AS A HOT WEDGE OR HOT AIR WELDER. THE FABRICATORSHALL HAVE EXPERIENCE IN WELDING A MINIMUM OF 2,000,000 SQUARE FEETOF GEOMEMBRANE FABRIC USING A THERMAL WELDING SYSTEM. THEMINIMUM WIDTH OF FACTORY SEAMS SHALL BE 2". ALL SEAMS SHALL BEINSPECTED TO ENSURE THE QUALITY AND UNIFORMITY OF THE WELDS. ANYPORTION OF THE WELD AREA THAT DOES NOT PASS VISUAL INSPECTION FORREASONS SUCH AS AN UNWELDED EDGES, EXPOSURE OF THE SCRIM, ETC,MUST BE REPAIRED BY THERMAL WELDING OR THE USE OF A PROPERWELDING ROD MATERIAL PRIOR TO THE PANEL BEING SHIPPED.IN ADDITION TO VISUAL INSPECTION, A 48" SAMPLE SHALL BE TAKEN FROMEACH FACTORY SEAM WELDING UNIT USED IN THIS WORK AT THE BEGINNINGOF EVERY WORK SHIFT AND EVERY FOUR HOURS OF PRODUCTIONTHEREAFTER. SAMPLES SHALL BE NON-DESTRUCTIVE AND SHALL NOTREQUIRE PATCHING OF FABRICATED PANELS. TEST SPECIMENS SHALL BECUT AT QUARTER POINTS FROM EACH 48" SEAM SAMPLE (A TOTAL OF 3PLACES) AND TESTED FOR FACTORY SEAM STRENGTH AND PEEL ADHESION.THE SHEAR SEAM STRENGTH SHALL BE TESTED IN ACCORDANCE WITH ASTMD75 1 AS MODIFIED IN ANNEX A OF 54. A LOG SHALL BE MAINTAINED SHOWINGTHE DATE, TIME, PANEL NUMBER AND TEST RESULTS. FAILURE OF THEMATERIAL SEAMS TO MEET ALL OF THE REQUIREMENTS OF THESESPECIFICATIONS SHALL BE CAUSE FOR REJECTION OF THE MATERIAL SEAMS.THE FABRICATOR SHALL PROVIDE THE TEST RESULTS TO THE PONDENGINEER AND / OR OWNER UPON REQUEST.2.2 FABRICATED PANEL PACKAGING AND STORAGEEACH FACTORY FABRICATED PANEL SHALL BE ROLLED ORACCORDION-FOLDED AND PLACED ONTO A STURDY WOODEN PALLETDESIGNED TO BE MOVED BY A FORKLIFT OR SIMILAR EQUIPMENT. EACHPANEL SHALL BE GIVEN PROMINENT AND UNIQUE IDENTIFYING MARKINGSINDICATING THE PROPER DIRECTION OF UNROLLING AND / OR UNFOLDING TOFACILITATE LAYOUT AND POSITIONING IN THE FIELD. THE PANELS SHALL BEPACKAGED AND FULLY ENCLOSED ON A WOODEN PALLET WITH PLASTICCOVER AND SHRINKWRAP AND PROTECTED TO PREVENT DAMAGE DURINGSHIPMENT AND EACH CRATE IS TO BE PROMINENTLY MARKED IN THE SAMEFASHION AS THE PANELS WITHIN. UNTIL NEEDED, PACKAGED FACTORYFABRICATED PANELS SHALL BE STORED IN THEIR ORIGINAL UNOPENEDCRATES IN A DRY AREA, AND PROTECTED FROM THE DIRECT HEAT OF THESUN. DO NOT STACK PALLETS.3.0 INSTALLATION AND FIELD SEAMING3.1 SUBGRADE PREPARATIONTHE SURFACES ON WHICH THE LINING IS TO BE PLACED SHALL BEMAINTAINED IN A FIRM, CLEAN, DRY AND SMOOTH CONDITION DURING THELINING INSTALLATION. ALL EARTHEN SURFACES TO RECEIVE THE LININGSHALL BE COMPACTED AND SMOOTH GRADED WITH FREEBOARDANCHORAGES AS SHOWN ON THE POND SYSTEM DETAILS. ALL SURFACES TORECEIVE THE LINING SHALL BE FREE OF ROCKS, ROOTS, GRAVEL, GRADESTAKES OR DEBRIS THAT MAY PUNCTURE THE GEOMEMBRANE. THESUBGRADE SURFACE TO RECEIVE THE LINING SHALL BE COMPACTED INACCORDANCE WITH THE PROJECT GRADING PLANS. ALL VEGETATION, IFPRESENT, SHALL BE REMOVED. IF GROUNDWATER IS PRESENT WITHIN 12"BELOW THE SURFACE TO BE LINED, THE AREA SHALL BE DEWATERED PRIORTO, AND DURING THE INSTALLATION OF THE LINER. THE LINER SHALL BEINSTALLED AT A HEIGHT ABOVE THE MAXIMUM ANTICIPATED HEIGHT OF THEGROUNDWATER TABLE IF GROUNDWATER IS PRESENT ON THIS SITE.THE LOCATION OF BOTH THE TOP AND BOTTOM OF ALL SLOPES SHALL BECOMPLETED WITHIN PLUS OR MINUS 1 FOOT OF THE PLANED LOCATION. THECOMPLETED FINISH GRADES SHALL BE WITHIN PLUS OR MINUS 0.1 FOOT OFTHE SPECIFIED ELEVATION, UNLESS OTHERWISE NOTED ON THESE PLANS.IMMEDIATELY PRIOR TO THE INSTALLATION OF THE GEOMEMBRANE, ACOMPLETE AND DETAILED INSPECTION OF THE EMBANKMENTS SHALL BEPERFORMED BY THE FIELD ENGINEER, EARTHWORK CONTRACTOR ANDGEOMEMBRANE INSTALLER TO DETERMINE ACCEPTANCE OF THE FINISHEDSUBGRADE AND ELEVATIONS. ANY EROSION OR OTHER DAMAGE TO THEBASE MATERIAL WHICH HAS OCCURRED SINCE PLACEMENT SHALL BECORRECTED BY THE GRADING CONTRACTOR.3.2 GEOMEMBRANE INSTALLATIONTHE GEOMEMBRANE SHALL BE PLACED OVER THE PREPARED SURFACES INSUCH A MANNER AS TO INSURE MINIMUM HANDLING AND IN ACCORDANCEWITH THE APPROVED SHOP DRAWINGS AND THE POND PLANS. THE LININGSSHALL BE SEALED TO ALL CONCRETE STRUCTURES AND OTHER OPENINGS INACCORDANCE WITH DETAILS SHOWN HERE AND IN THE APPROVEDFABRICATOR'S SHOP DRAWINGS. THE GEOMEMBRANE LINING SHALL BECLOSELY FITTED AND SEALED AROUND ALL INLETS, OUTLETS AND OTHERPROJECTIONS THROUGH THE LINING USING PREFABRICATED FITTINGS (PIPEBOOTS) AS SHOWN ON THESE PLANS. LINER SHEETS DAMAGED FROM ANYCAUSE SHALL BE REMOVED, REPAIRED, OR COVERED WITH ADDITIONALSHEETING.ONLY THOSE SHEETS OF LINING MATERIAL WHICH CAN BE ANCHORED ANDSEAMED TOGETHER THE SAME DAY SHALL BE UNPACKED AND PLACED INTOPOSITION. IN AREAS WHERE HIGH WIND IS PREVALENT, THE LININGINSTALLATION SHALL BEGIN ON THE UPWIND SIDE OF THE PROJECT ANDPROCEED DOWNWIND. THE LEADING EDGE OF THE LINER SHALL BESECURED AT ALL TIMES WITH SANDBAGS SUFFICIENT TO HOLD IT DOWNDURING HIGH WINDS. THE LEADING EDGES OF THE LINER MATERIAL LEFTEXPOSED AFTER THE DAY'S WORK SHALL BE ANCHORED TO PREVENTDAMAGE OR DISPLACEMENT DUE TO WIND.MATERIALS, EQUIPMENT OR OTHER ITEMS SHALL NOT BE DRAGGED ACROSSTHE SURFACE OF THE LINER OR BE ALLOWED TO SLIDE DOWN SLOPES ONTHE LINING. ALL PARTIES WALKING OR WORKING ON THE LINING MATERIALSSHALL WEAR SOFT SOLED SHOES.3.3 FIELD SEAMSLAP JOINTS SHALL BE USED TO SEAL FACTORY FABRICATED SHEETSTOGETHER IN THE FIELD. THE LAP JOINT SHALL BE FORMED BY LAPPING THEEDGES OF THE SHEETS FOUR (4) TO SIX (6) INCHES. THE CONTACTSURFACES OF THE SHEETS SHALL BE WIPED CLEAN OF ALL DIRT, DUST,MOISTURE AND OTHER FOREIGN MATTER. A MINIMUM 2" BOND SHALL APPLYTO ALL FIELD SEAMS. EXTREME CARE SHALL BE TAKEN THROUGHOUT THEWORK TO AVOID FISHMOUTHS, WRINKLES, FOLDS OR PLEATS IN THE SEAMAREA. IF FISHMOUTHS DO OCCUR, THEY SHALL BE SLIT OUT FAR ENOUGHFROM THE SEAM TO DISSIPATE THEM, LAPPED, SEAMED TOGETHER IN THELAPPED AREA AND PATCHED. ANY NECESSARY REPAIRS TO THEGEOMEMBRANE SHALL BE DONE USING AN ADDITIONAL PIECE OF THESPECIFIED SHEETING APPLIED AS STATED IN SECTION 4 OF THISSPECIFICATION. CLEANUP WITHIN THE LINING COMPOUND SHALL BE ANONGOING RESPONSIBILITY OF THE LINING INSTALLER. PARTICULAR CARESHALL BE TAKEN TO ENSURE THAT NO STONES, SCRAP MATERIAL, TRASH,TOOLS OR OTHER UNWANTED ITEMS ARE TRAPPED BENEATH THE LINER.ALL FIELD SEAMS SHALL BE MADE UTILIZING THE HOT AIR OR HOT WEDGEWELDING TECHNIQUES AS OUTLINED IN APPROPRIATE SECTIONS OF THE EPATECHNICAL GUIDANCE DOCUMENT "INSPECTION TECHNIQUES FOR THEFABRICATION OF GEOMEMBRANE FIELD SEAMS".4.0 INSPECTION AND TESTING OF SEAMS4.1 INSPECTIONUPON COMPLETION OF THE LINER INSTALLATION, ALL SEAMS SHALL BEVISUALLY INSPECTED FOR COMPLIANCE WITH THESE SPECIFICATIONS ANDTHE POND PLANS. IN ADDITION TO VISUAL INSPECTION, ALL FIELD SEAMSSHALL BE CHECKED USING AN AIR LANCE NOZZLE DIRECTED ON THE UPPEREDGE AND SURFACE TO DETECT ANY LOOSE EDGES OR RIFFLES INDICATINGUNBONDED AREAS WITHIN THE SEAM (PER ASTM D4437). ANY DEFECTS INTHE WELD SHALL BE REPAIRED BY THERMAL WELDING.ALL FIELD SEAMS, ON COMPLETION, SHALL BE TIGHTLY BONDED. ANYGEOMEMBRANE SURFACE SHOWING INJURY DUE TO SCUFFING,PENETRATION BY FOREIGN OBJECTS, OR DISTRESS FROM OTHER CAUSESSHALL BE REPLACED OR REPAIRED. ALL EXPOSED SCRIM EDGES SHALL BESEALED WITH AN APPROVED EXTRUSION WELDING BEAD OR CAP STRIPPED.4.3 TESTING OF FIELD SEAMSTEST SEAMS ARE TO BE MADE BY EACH SEAMING CREW AT THE BEGINNINGOF THE SEAMING PROCESS, AND EVERY FOUR (4) HOURS THEREAFTER, OREVERY TIME THE WELDING EQUIPMENT IS CHANGED. EACH SEAMING CREWAND THE MATERIALS THEY ARE USING SHALL BE TRACEABLE ANDIDENTIFIABLE TO THEIR TEST SEAMS. THE SAMPLES SHALL BE NUMBERED,DATED, IDENTIFIED AS TO THE PERSONNEL MAKING THE SEAM, ANDLOCATION MADE, BY APPROPRIATE NOTES ON A PRINT OF THE PANELLAYOUT FOR THE PROJECT. THE COMPLETED FIELD SEAM SAMPLE SHALLMEASURE NOT LESS THAN 14" IN WIDTH AND 24" IN LENGTH.THE FIELD TEST SEAMS ARE TO BE TESTED FOR ADHESION BY USE OF AN AIRLANCE TESTING MACHINE. IF A TEST SEAM FAILS TO MEET THE FIELD SEAMDESIGN SPECIFICATION, THEN ADDITIONAL TEST SEAM SAMPLES WILL HAVETO BE MADE BY THE SEAMING CREW, USING THE SAME TOOLS, EQUIPMENTAND SEAMING MATERIALS, AND RETESTED.5.0 WARRANTYTHE LINING MANUFACTURER SHALL PROVIDE A PRO-RATA WEATHERINGWARRANTY FOR THE GEOMEMBRANE LINER PRODUCT THAT IT IS FREE FROMMANUFACTURING DEFECTS AT THE TIME OF SALE AND AGAINSTDETERIORATION DUE TO THE EFFECTS OF ULTRAVIOLET LIGHT FOR A PERIODOF UP TO 20 YEARS FROM THE DATE OF THE COMPLETED INSTALLATION. THEWARRANTY WILL BE IN FORCE ONLY AFTER THE OWNER OR LEGALREPRESENTATIVE OF THE ENTITY OWNING THE INSTALLED LINER HAS SIGNEDTHE WARRANTY.PIPETAC-TAPESTAINLESSSTEEL CLAMPPIPE BOOTSKIRT WELDALL 4 SIDESPREPAREDSUBGRADEPIPE BOOTPROVIDE SLACKAT BENDED EDGEFIELD SEAM (4)SIDESGEOMEMBRANELINERPIPEBOOTFactory Fabricated Pipe Boot(vertical) ALL PIPE SIZESGeomembrane LinerSpecifications:Contact:TITAN ENVIRONMENTAL, USA950 Beaumont Ave, #830,Beaumont, CA, 92223Mr. Daniel Watson ph: 951-630-0401,daniel.watson@titanenviro.comwww.titanenviro.comSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comNONESCALE:03-28-202503-28-2025La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA05-23-25 PER TOWN COMMENTS2Page 729 3'-0"6"6"EQ.EQ.1'-6" CURB1'-0"3"6'-0" (MINIMUM)RETURN3'-0"RETURN6'-0"TROUGH WIDTHCTROUGHWHERE SHOWNON PLANTOE OF SLOPESECSECSECSEC SHORELINETREATMENT ASCALLED OUT ON LAKEPLAN VIEWEARTH COVEROVER MEMBRANELINERSELECTSOILCOVERFORM TROUGH WALLSWITH HAND FORMEDCONCRETEREINFORCED WITHHAND BENT WIREREINF. AS SHOWN3" THICKCONCRETEVENEER REINF. w/1"x1"x20ga.OCTAGONAL WIREMESH OVERMEMBRANE LINERTROUGHPLAN VIEWSECTIONSCALE: 1-1/2" = 1'-0"SCALE: 1/2" = 1'-0"6"6"EQ.EQ.1'-6" CURB1'-0"3"SELECTSOILCOVERFORM TROUGH WALLSWITH HAND FORMEDCONCRETEREINFORCED WITHHAND BENT WIREREINF. AS SHOWNSECTIONSCALE: 1-1/2" = 1'-0"LAKE LIMITS AS SHOWN ON PLANDEPTH PER PLAN VARIES 4'-0" MIN.TO 6'-0" MAX.3" MIN.WATERSURFACEELEVATIONPERPLANLAKEEDGESHOWN ONPLAN 3'-6" MINIMUMDISCHARGEPIPE (LINESIZEPER PLAN)SEAL DISCHARGEPIPE TO LINER ASSHOWN PERDETAIL .ALK3.3CONCEAL FILLPIPE WITHPLANTING ANDROCKS - SEEPLAN VIEWPAINT ALLEXPOSEDPIPELINESBLACK INCOLOR TOCONCEALUSE GROUTED ROCKTO PREVENT EROSIONWHEN FILLINGSHORELINE ASSHOWN PERDETAIL .ALK3.1Note:FOR ALTERNATE LINER SUBGRADETREATMENTS (NOT SHOWN HERE)SEE DETAILALK2.11'-3"6"MIN.PER DETAIL112LAKE EDGE PER PLANVARIES WITH ROCKFILL PIPEPER PLAN1'-0" MIN.PAINT ALLEXPOSEDPIPELINE BLACKIN COLOR TOCONCEALALK3.1SPANBOULDERSOVER FILL PIPETO FURTHERCONCEALWATERSURFACEELEVATIONPERPLAN6" MIN.SHORELINEBEYONDPERCONSTRUCTROCK POCKET ASSHOWN TORECEIVE ROCKS -GROUT ROCKSSOLID IN PLACEWITH CONCRETELAKE LIMITS AS SHOWN ON PLANNote:FOR ALTERNATE LINER SUBGRADETREATMENTS (NOT SHOWN HERE) SEE DETAILALK2.1LAKE WATERSURFACE EL.PER PLAN3'-0"FREEBOARDELEVATIONPER PLAN3" 6"8"6'-0" (APPROXIMATELY)LAKESHORETREATMENTPERLAKE SHORELINE SHOWN ON PLAN STORMFLOW#3 BARS @24" O.C.CONTINUOUS(4) #3 BARSHORIZONTALCONTINUOUSPOURED INPLACECONCRETECUT-OFF WALLCONTINUOUSTERMINATE LINER HEREALK3.1COVER CONCRETE VENEERWITH "SPOILS" TREATMENT TOTHE DEPTH SHOWN ON THECROSS SECTION - COLOR OF"SPOILS" TREATMENT TOMATCH COLOR OF ROCK ANDCOBBLE (TYPICAL)3" MIN. THICK CONCRETEVENEER REINFORCEDWITH 1" x 1" x 20ga.OCTAGONAL WIRE MESHOVER LINER TO LIMITSSHOWN ON PLAN VIEWCAREFULLY PREPARED LINER SUBGRADE PER THEREQUIREMENTS OF THE LAKE SYSTEM GENERAL NOTES -TYPICAL THROUGHOUT LAKE BOTTOM & SHORE SURFACESLAKE SYSTEM MEMBRANE LINER AS CALLED OUT INGENERAL NOTES - INSTALL PER THE REQUIREMENTSOF THESE PLANS AND THE LINER MANUFACTURER"Spoils" Note:FOR MATERIALS ANDINSTALLATION OFDECORATIVE SPOILSSEE LAKE SHORELINETREATMENT DETAILS(TYPICAL)Note:FOR ALTERNATE LINERSUBGRADETREATMENTS (NOTSHOWN HERE) PERALK2.1SHOWN ON PLAN - CONCEALWEIR W/ COBBLE AS SHOWNCOBBLE BOTTOM WHEREVENEER REINFORCED W/WIRE MESH OVER MEMBRANELINER PER GENERAL NOTES1" X 1" X 20 GA. OCT.POND BOTTOMPER PLAN3" THICK CONCRETEEQUAL6"EQUAL11LIMITS OF POND PER PLANLINER FLAP CONT. AS SHOWN- ADHERE TO MEMBRANE LINERW/ LINER-TO-LINER ADHESIVETOP OF WEIRELEV. PER PLANPOND WATERSURFACE ELEV.PER PLANC WEIR1-1/2"1-1/2"1/2" 1/2"PER LINER MFR.10" TYPICAL FOR MORE INFO.PER PLAN - SEE DETAILLK3.5ALK3.6ASTRM WFALLSTREAM / WATERFALLSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:SCALE:1" = 1'-0"SCALE:3/4" = 1'-0"3/4" = 1'-0"SCALE:AS SHOWNSCALE:SCALE:1-1/2" = 1'-0"1" = 1'-0"SCALE:AS SHOWNSCALE:AS SHOWN03-28-202503-28-2025La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA05-23-25 PER TOWN COMMENTS2Page 730 TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"3'-8"TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"3'-8"TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"3'-8"BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)FILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)SELECT 3'-0" HIGHBOULDER - SLOPEBACKFILL TO TERMINATEAT BACK OF BOULDEREXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATION1'-6"APPROX.DRAWDOWNPER GCSUPER.11 (MAXIMUM)13 (VFY)DETAIL "1"DETAIL "2"DETAIL "3"1'-6"APPROX.DRAWDOWNPER GCSUPER.1'-6"APPROX.DRAWDOWNPER GCSUPER.BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYFILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)SELECT ROCKS AGAINSTEXISTING VERTICAL WALL -SLOPE BACKFILL TOTERMINATE AT BACK OFBOULDEREXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATION11 (MAX.)13 (VFY)BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH #3BARS @ 16" O.C. 4" MIN.EMBEDMENT HILTI HY 200V3 EPOXY (ESR 4868)STACKED 12" CONCRETECMU BLOCKS - SECURE INPLACE WITH NON-SHRINKGROUT (TYP.)RUN SPOILS TREATMENTOVER CMU BLOCKS ANDGROUT AS SHOWN TOCONCEAL - MEET GRASSAT LAKE WATER LEVELEXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATION11 (MAXIMUM)13 (VFY)EXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)EXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"TOP OFFOOTING.ELEV. +345.50LAKE WATERSURF. ELEV.+347.50TOP OFFREEBOARDEL. +348.005'-0"T.O. WALLELEV. +349.50(EXISTING)2'-0"2'-0"1'-0"1'-0"2'-0"6"4'-0"4'-4"DETAIL "1"DETAIL "2"1'-6" APPROX. DRAWDOWN PER GC SUPER. 1'-6" APPROX. DRAWDOWN PER GC SUPER.BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXTEND 4" THICKCONCRETE VENEER (f'C =2500psi MIN.) OVEREXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)SELECT ROCKS AGAINSTEXISTING VERTICAL WALL -SLOPE BACKFILL TOTERMINATE AT BACK OFBOULDEREXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACECOVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATIONEXTEND 4" THICK CONCRETEVENEER (f'C = 2500psi MIN.)OVER EXISTING PVC LINERREINFORCED WITH 1" x 1" x20ga. OCT. WIRE MESHCONTINUOUS - PROVIDEEPOXY DOWEL INTOEXISTING VENEER WITH 18"LONG #3 BARS @ 16" O.C. 4"MIN. EMBEDMENT HILTI HY200 V3 EPOXY (ESR 4868)STACKED 12" CONCRETECMU BLOCKS - SECURE INPLACE WITH NON-SHRINKGROUT (TYP.)RUN SPOILS TREATMENT OVER CMU BLOCKSAND GROUT AS SHOWN TO CONCEAL - MEETGRASS AT LAKE WATER LEVEL11 (MAXIMUM)13 (VFY)3"6"3"FILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)SPECIAL SOIL MIX FORWATER PLANTS ASSPECIFIED BY THE PROJECTLANDSCAPE ARCHITECT (IFREQUIRED) - VERIFY MIXWITH LANDSCAPE ARCH INTHE FIELDNote:AQUATIC PLANT DESIGN AND INSTALLATION BY OTHERS - VARIOUSWATER PLANTS AS SPECIFIED BY THE LANDSCAPE DESIGNER - NOT APART OF WATER FEATURE CONSTRUCTION11 (MAX.)BACKFILL AND COMPACT SOIL BEHINDBOULDER WALL TO 90% RELATIVEDENSITYEXISTING WALL FOOTING AND PVC LINER TO REMAIN IN PLACE. DONOT COMPROMISE CONCRETE WALL OR LINEREXISTING DRAINAGE BOARD AND DRAINPIPE TO REMAIN IN PLACEFILL ALL VOIDS BETWEENROCKS AND CONCRETEVENEER SOLID WITHNON-SHRINK GROUT (TYP.)Note:AQUATIC PLANT DESIGN AND INSTALLATION BY OTHERS - VARIOUSWATER PLANTS AS SPECIFIED BY THE LANDSCAPE DESIGNER - NOT APART OF WATER FEATURE CONSTRUCTION3"6"3"COVER ALL EXPOSED CONCRETE VENEER (EXISTING AND NEW) WITH"SPOILS" - SEE "SPOILS TREATMENT NOTE" FOR MORE INFORMATIONSPECIAL SOIL MIX FORWATER PLANTS ASSPECIFIED BY THE PROJECTLANDSCAPE ARCHITECT (IFREQUIRED) - VERIFY MIXWITH LANDSCAPE ARCH INTHE FIELD2'-0"1'-0"13 (VFY)1'-0"2'-0"4'-4" SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:3/4" = 1'-0"SCALE:3/4" = 1'-0"03-28-202503-28-2025La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA05-23-25 PER TOWN COMMENTS2Page 731 LO C A T I O N O FE X I S T I N G L A K ESHORELINE EDGE -E X I S T I N G E D G EC O N S I S T S O FSLOUGHED OFF SOILA N D S O D I N A NIRREGULAR SHAPEA N D P O S I T I O NOVERFILL THIS AREA ASSHOWN TO ALLOW FORCUTTING OF THE LAKESHORELINE CONTINUOUSTHE LAKE EDGE SHALL BE FILLED WHERE SHOWN ON THE PLAN VIEWIN COMPACTED LIFTS PER THE REQUIREMENTS OF THE LAKEGRADING AS CALLED OUT IN THE "LAKE EDGE GRADING NOTES"SHOWN THIS DETAILLake Edge Over excavation and Compacted Fillonly occurs in lake edge "fill" areas shown on the lake plan viewWATERSURF. ELEXISTING2'-0" (MIN.) 4'-0" (MINIMUM)SEE PLAN VIEW FOREXISTING LAKE LIMITSSEE PLAN VIEW FORNEW LAKE LIMITS5'-0" (MIN.)EXISTING LAKEEDGE PER PLAN OVER EXCAVATE AND FILL PER NOTES LK3.1ANEW LAKE SHORELINE TREATMENTWHERE SHOWN ON THE LAKE PLAN VIEWAND TO BE CONSTRUCTED PER DETAILN E WLAKEEDGEP E RPLANVIEW FILL AREA TO LIMITS SHOWN ON PLANVIEW WHERE SHOWN ON PLANLake Edge Grading Notes(does not apply to project mass grading)1. ALL WORK SHALL CONFORM TO THE LATEST ADOPTED EDITION OF THE BUILDING CODE AND ALL LOCAL CODES AND ORDINANCES. AN EFFORT HAS BEEN MADE TO DEFINE THE LOCATION OF UNDERGROUNDFACILITIES WITHIN THE WORK AREA. HOWEVER, ALL EXISTING UTILITY AND OTHER UNDERGROUND STRUCTURES MAY NOT BE SHOWN ON THIS PLAN AND THEIR LOCATION WHERE SHOWN SHALL BE DEEMED TOBE APPROXIMATE. THE OWNER SHALL BE RESPONSIBLE FOR LOCATING, MARKING AND IF NECESSARY, SHUTTING DOWN AND/OR RELOCATING ALL UNDERGROUND UTILITIES AND RELATED FACILITIES ORIRRIGATION LINES AND FOR PROTECTING SAME DURING THE COURSE OF CONSTRUCTION. THE OWNER SHALL CONTACT UNDERGROUND SERVICE ALERT (U.S.A.) AT 1-800-542-2444 2 WORKING DAYS PRIOR TO THESTART OF CONSTRUCTION FOR ASSISTANCE FROM THE RESPECTIVE UTILITIES. ALL UTILITIES NOT A MEMBER OF U.S.A. SHALL ALSO BE NOTIFIED.2. ALL AREAS TO RECEIVE FILL SHALL BE CLEARED OF ALL BRUSH AND OTHER OBJECTIONABLE DEBRIS, INCLUDING EXISTING SOD AND OTHER ORGANIC MATERIALS, SCARIFIED TO A DEPTH OF 1 FOOT ANDWATERED AND COMPACTED TO 90% RELATIVE DENSITY IN LAKE AREAS PER THE REQUIREMENTS OF A.S.T.M. DESIGNATION D-1557-65T, OR AS APPROVED BY THE LAKE ENGINEER. THE FILL MATERIAL SHALL BEPLACED IN COMPACTED LAYERS AS SHOWN ON THE LAKE EDGE CONSTRUCTION DETAILS AND FILLED AND COMPACTED AT OPTIMUM MOISTURE CONTENT BY AN APPROVED METHOD. THIS PROCEDURE SHALLAPPLY ONLY TO THE LAKE SHORELINE FILLS ON THIS PROJECT AND IS NOT INTENDED TO BE USED FOR BUILDINGS OR OTHER STRUCTURES.3. ALL EXISTING LAKE BOTTOM SOIL SHALL BE REUSED IN THE LAKE AREA, WITH REMOVED ORGANICS, BUSHES, TREES, ETC. TO BE STOCKPILED ADJACENT TO THE LAKE FOR REMOVAL / DISPOSAL BY THEOWNER.4. THE CONTRACTOR SHALL EMPLOY ALL LABOR, EQUIPMENT AND METHODS REQUIRED TO PREVENT HIS OPERATIONS FROM PRODUCING DUST IN AMOUNTS DAMAGING TO PROPERTY, CULTIVATEDVEGETATION AND DOMESTIC ANIMALS, OR CAUSING A NUISANCE TO PERSONS OCCUPYING BUILDINGS IN THE VICINITY OF THE JOB SITE. THE OWNER SHALL PROVIDE A SUFFICIENT WATER SOURCE FORCONSTRUCTION WATER AND SHALL BE RESPONSIBLE FOR ALL WATER COSTS THROUGHOUT THE COMPLETION OF THE LAKE CONTRACTOR'S WORK.5. THE OWNER SHALL DESIGNATE WORK EQUIPMENT TRAVEL PATHS THRU THE PROJECT WHICH ALLOWS THE CONTRACTOR TO ACCESS THE WORK AREA WITH EQUIPMENT AND SHALL ALTER GOLF PLAY ASREQUIRED TO PROTECT THE SAFETY OF THE CONTRACTORS WORKMEN DURING THE COURSE OF THE WORK. THE CONTRACTOR SHALL MAKE A REASONABLE EFFORT TO PROTECT EXISTING IRRIGATIONCOMPONENTS ETC. DURING THE COURSE OF THE WORK HOWEVER THE OWNER SHALL BEAR THE COSTS OF REPAIRING OR REPLACING ANY AND ALL COMPONENTS AND / OR LANDSCAPING DAMAGED WITHIN THEDESIGNATED ACCESS AREAS AFTER THE COMPLETION OF THE WORK.6. THE LAKE CONTRACTOR SHALL MAINTAIN A CURRENT, COMPLETE AND ACCURATE RECORD OF ALL CHANGES WHICH DEVIATE FROM THE CONSTRUCTION AS PROPOSED IN THESE PLANS ANDSPECIFICATIONS FOR THE PURPOSE OF PROVIDING THE LAKE ENGINEER WITH A BASIS FOR RECORD DRAWINGS. NO CHANGES SHALL BE MADE WITHOUT PRIOR APPROVAL OF THE OWNER'S REPRESENTATIVEAND THE LAKE ENGINEER. IN THE EVENT THAT THE CONTRACTOR NOTICES IRREGULARITIES IN THE LINE OR GRADE HE SHALL BRING IT TO THE IMMEDIATE ATTENTION OF THE LAKE ENGINEER AND THE OWNER'SREPRESENTATIVE FOR A PROPER RESOLUTION. IF HE FAILS TO DO SO, THE CONTRACTOR SHALL BE RESPONSIBLE FOR ANY ERROR IN THE GRADE AND NECESSARY RECONSTRUCTION TO CORRECT SUCH ERROR.7. THE LAKE CONTRACTOR AGREES THAT IN ACCORDANCE WITH GENERALLY ACCEPTED CONSTRUCTION PRACTICES THE LAKE CONTRACTOR SHALL WORK WITH THE OWNER TO PROVIDE FOR THE GOODCONDITION OF THE JOB SITE DURING THE COURSE OF CONSTRUCTION FOR THE PROJECT INCLUDING THE SAFETY OF ALL PERSONS AND PROPERTY AND THAT THIS REQUIREMENT SHALL BE MADE TO APPLYCONTINUOUSLY AND NOT BE LIMITED TO NORMAL WORKING HOURS.8. NEITHER THE OWNER, NOR THE LAKE ENGINEER WILL ENFORCE SAFETY MEASURES OR REGULATIONS AS THEY PERTAIN TO THE LAKE CONTRACTOR. THE LAKE CONTRACTOR SHALL DESIGN, CONSTRUCTAND MAINTAIN ALL SAFETY DEVICES, INCLUDING SHORING AND SHALL BE SOLELY RESPONSIBLE FOR CONFORMING TO ALL LOCAL, STATE AND FEDERAL SAFETY AND HEALTH STANDARDS, LAWS ANDREGULATIONS. THE LAKE CONTRACTOR SHALL PROVIDE TO THE OWNER, PRIOR TO THE START OF WORK, WORKER'S COMPENSATION INSURANCE, PRODUCTS AND COMPLETED OPERATIONS INSURANCE ANDCOMPREHENSIVE LIABILITY INSURANCE CERTIFICATES.IMPORTANT!! BECAUSE OF THE UNCERTAINTY OF THE VOLUME OF ORGANICS ON THE BOTTOM OF THE LAKE, IT IS IMPOSSIBLE TO BE ACCURATE WITH THE GRADING QUANTITIES. IT IS THE INTENT OFTHE OWNER AND THE LAKE ENGINEER THAT THE ORGANIC MATERIAL BE MIXED WITH THE EXISTING SOIL BENEATH THE ORGANICS IN SUCH A MANNER SO AS TO MAKE IT SUITABLE FOR THE SUBGRADE BENEATHTHE LAKE LINER. THE LAKE SIZE AND SHAPE AS DEPICTED HERE SHALL BE ADJUSTED IN THE FIELD SO THAT NO IMPORT OR EXPORT OF MATERIAL IS REQUIRED. THE OWNER SHALL DETERMINE THOSE AREAS TORECEIVE LESS OR MORE FILL AS REQUIRED TO BALANCE THE MATERIAL.F R E E B O A R DE L E V . P E RS H O R E L I N ED E T A I LL A K E W A T E RS U R F A C E E L .P E R P L A N6"6'-0" APPROXIMATELYLAKE - WIDTH VARIES PER PLANLAKE SHORELINE SHOWN ON PLAN "LAID BACK" SHORELINEAS SHOWN PER DETAIL .ALK3.1SEAL EQUALIZER PIPETO SHORELINE ASSHOWN ON THE LINERDETAIL .ALK3.32'-0"(MINIMUM)LAKE 162-1/2" dia.6" 3'-8"8" 6" (MIN.) AIR GAP POND BOTTOMSURFACE ANDSHORELINE FINISHSURFACETREATMENT SHALLBE AS CALLED OUTON SHORELINEDETAIL (TYPICAL)CONCEAL FILL PIPE WITH PLANTING ANDROCKS - SEE PLAN VIEWPAINT ALL EXPOSED PIPELINES BLACK INCOLOR TO CONCEAL2"dia. SCH 40 PVCEQUALIZER PIPELINESIZE SCH 40 PVC DISCHARGE PIPE PERLEVEL CONTROL TABLE2"dia. SCH 40 PVCEQUALIZER PIPEMECHANICAL LEVELCONTROL VALVE BOXPLASTIC VALVE BOX PER "CARSON" 24SERIES OR ENGINEER APPROVED EQUALWITH BOLT-DOWN LIDCONTACT:(www.oldcastleinfrastructure.com)M E C H A N I C A LLEVEL CONTROL VALVEVALVE PER "CLA-VAL" MODEL#124-14 FLOATACTUATED LAKE LEVEL CONTROL VALVEWITH CLASS 150 STEEL BODY ANDTHREADED ENDS, #304 S.S VALVE TRIM ANDBUNA N SYNTHETIC RUBBER PARTS -IMPORTANT!!! THIS VALVE ISDESIGNED TO OPEN ONLY WHENSUFFICIENT PRESSURE IS AVAILABLE FROMTHE IRRIGATION STATION SYSTEM MAIN LINE- SET TO OPEN ONLY ABOVE 88 PSI (VERIFY)- USE #X102A THROTTLING SYSTEM300S-20-200 @ 88psiCONTACT: www.cla-val.comLINESIZE BRONZEGATE VALVECONCEAL VALVEBOX w/ PLANTING(BY OTHERS)LINESIZE SCH 80 PVC SLIP / THREADADAPTOR WITH S.S. STRAP ANDTHREAD END (TYPICAL (2) PLACES)ADD PEA GRAVEL UNDER MECHANICALLEVEL CONTROL VALVE BOX FORDRAINAGELAKE FILL PIPE FROMDOMESTIC WATER SOURCEIMPORTANT!!ALL PVC INSIDE MECHANICAL LEVELCONTROL VALVE BOX SHALL BE SCH 80- ALLPIPE OUTSIDE THE VALVE BOX SHALL BESCH 40 (TYPICAL)USE 10"dia. 100 PSI P.I.P. PIPE ASSHOWN FOR STILLING WELL10" x 2" SCH 40PVC SADDLE10" 100 PSI P.I.P.PIPE CAP2'-6"USE GROUTED ROCK TO PREVENT EROSIONWHEN FILLING1'-0" (MIN.) SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:1" = 1'-0"SCALE:1/2" = 1'-0"La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 732 +5+0-5-10+6+4+3+2+1-1-2-3-4-8-6-7-9+5+0-5-10+6+4+3+2+1-1-2-3-4-8-6-7-9+7+8+9+10+11+12+7+8+9+10+11+126'-0"(APPROX.)LAKE - WIDTH VARIES PER PLANSHORELINESHOWN ONLAKE PLAN 4'-0"(MIN.)LAKE WATERSURFACEELEVATIONPER PLANLAKE LINERELEVATION PERPLANDEPTH PER PLAN EQUAL APPROX.(SEE LAKE PLAN)EQUAL APPROXIMATELY (SEE LAKE PLAN)AERATIONDIFFUSERAS SHOWNPERBLK4.2AERATIONVALVE BOXAS SHOWNPERALK4.2LAID BACK SHORELINETREATMENT PERRUN NON-PERFORATED WEIGHTED HOSE IN 2"dia. SCH 40 PVCSLEEVE - CUT HOLE IN VALVE BOX TO FIT OUTSIDE DIAMETEROF SLEEVE - DO NOT USE FITTINGS IN SLEEVE OTHER THANLONG SWEEP FITTINGS TO AVOID CRIMPING IN WEIGHTED HOSE- WEIGHTED HOSE TERMINATES AFTER HOSE EXITS CONCRETEVENEER AT A MINIMUM OF 3'-0" DEPTH3/4"dia. WEIGHTED HOSE PERDIFFUSER MANUFACTURERFILL THIS SPACE SOLIDWITH CONCRETELIMIT OF LAKE LINERBEYONDAERATIONSYSTEMPIPINGWHERESHOWN ONLAKE PLANALK3.1ALTERNATEDIFFUSERTHE LAKECONTRACTOR SHALLBID AN ALTERNATE TOTHIS DIFFUSER ASSHOWN ON DETAILBLK4.2WHERE EARTH COVEROCCURS ABOVE LINERSET DIFFUSER ATOPEARTH COVERMATERIAL (TYPICAL)Note:FOR ALTERNATE LINER SUBGRADE TREATMENTS(NOT SHOWN HERE) SEE DETAILALK2.1Aeration System Notes1. THE AERATION EQUIPMENT SYSTEM SHOWN ON THESEPLANS SHALL BE OF THE SINGLE-PISTON COMPRESSOR TYPECAPABLE OF PROVIDING A MINIMUM OF TEN (10) TURNOVERSOF THE ENTIRE LAKE SYSTEM VOLUME IN A 24-HOUR PERIOD.THE SYSTEM SHALL BE AS MANUFACTURED BY E.P. AERATIONOF SAN LUIS OBISPO, CALIFORNIA OR LAKE ENGINEERAPPROVED EQUAL. THE SYSTEM SHALL INCLUDE (2) 1/3hpCOMPRESSORS WITH ALL APPLICABLE ELECTRICALCOMPONENTS AND ACCESSORIES IN EACH CABINET. THEPOWER REQUIREMENTS FOR EACH CABINET IS . . . . . . 120vac,SINGLE PHASE, 18 AMPS. EACH CABINET SHALL BE MOUNTEDTO THE CONCRETE WALL AS SPECIFIED BY THE SYSTEMMANUFACTURER. THE AERATION CABINET SHALL BESUPPLIED WITH A 120v. SINGLE PHASE POWER CABLE WITHPLUG AS SHOWN.2. THE AERATION SYSTEM EQUIPMENT INCLUDESCOMPRESSORS ONLY..... NO OZONE!!THE AERATION SYSTEM MANUFACTURER SHALL PROVIDEPRODUCT CUT SHEETS AND SHOP DRAWINGS IN AUTOCADFORMAT TO THE LAKE ENGINEER FOR APPROVAL PRIOR TOPROVIDING PRICING TO THE LAKE CONTRACTOR. THE LAKEENGINEER SHALL DETERMINE IF THE AERATION EQUIPMENTSUPPLIED BY THE AERATION MFR IS SUITABLE FOR THISPROJECT.3. THE AERATION SYSTEM SUPPLIER SHALL PROVIDE AS APART OF HIS SYSTEM (6) SETS OF OPERATIONS ANDMAINTENANCE MANUALS WHICH CLEARLY DESCRIBE THEMAINTENANCE AND REPAIR OF EACH COMPONENT OF THESYSTEM. THE MANUALS SHALL BE 8-1/2 X 11 FORMAT BOUNDAND SHALL CONTAIN MANUFACTURER'S SHOP DRAWINGS,MATERIALS LISTS WITH SOURCES AND BOTH WRITTEN ANDGRAPHIC DESCRIPTIONS OF ALL MONTHLY, QUARTERLY ANDYEARLY MAINTENANCE PROCEDURES FOR ALL COMPONENTSOF THE SYSTEM. THE MANUFACTURER SHALL ALSO INCLUDEA TRIP TO THE SITE AFTER INSTALLATION FOR SYSTEMSTART-UP AND FOR 6-HOURS OF ON-SITE TRAINING OF THEPROJECT MAINTENANCE STAFF IN THE OPERATION ANDMAINTENANCE OF THE AERATION SYSTEM.Panel Mounting:L2x2x1/4 VERT. MOUNTED PANEL SUPPORTS SPACED TO FITTHE AER'N PANEL MOUNTING BRACKETS - CONNECT PANELTO SUPPORTS WITH STAINLESS STEEL BOLTS NUTS ANDWASHERS TO SIZE SPECIFIED BY AERATION SYSTEM PANELMANUFACTURER - SUPPORTS SHALL BE HOT-DIP GALVANIZEDPRIOR TO INSTALLATIONNote!!PANEL SHALL BEDESIGNED FOROUTDOOR USE(TYPICAL)PER VAULT DETAIL PER AERATIONCABINET MFR'SSHOP DRAWINGSCAERATIONCABINET2"dia.2"dia. PERVAULTDETAIL1"dia. BALL TYPEHOSE BIBB(NORMALLYCLOSED) TOALLOW FORDRAINAGE OFCONDENSATEISOLATION VALVEWITH INLINECHECK VALVE ASSUPPLIED BY THEAERATIONMANUFACTURERPRESSURE GAUGEAS SUPPLIED BYTHE AERATIONSYSTEM MFR (ONEPER COMPRESSOR)LINESIZE SCH40PVC PIPE ANDFITTING (TYP.)CLAMP AERATIONPIPES TO WALLWITH PRE-FAB PIPECLAMPS PER(TYPICAL)LK4.3AAERATION DISCH.PIPELINE TO VALVE ATLAKE EDGE WHERESHOWN ON PLAN VIEWPER DETAILLK4.2ALINESIZE TRU-UNION BALL VALVEIS NORMALLYOPENLINESIZE PVCSWING CHECKVALVE PER "FLO"SERIES 1520SOLVENT WELD TOSIZE SHOWN4 PLEX GFCIPROTECTED110v. OUTLETFROM SITEELECTRICALBY OTHERSPERVAULT DETAILSEAL AERATION PIPE TOCONCRETE FLOOR ASSHOWN ON PUMPSTATION DRAWINGSADJACENTCABINET WHEREOCCURS2'-0"SPACE BETWEENCABINETS(TYPICAL)2"dia.AERATIONDISCHARGE WHENIN VAULT (TYP)SEE VAULT DETAILFOR SPACINGBETWEEN CABINETSWHEN IN VAULTPERVAULTDETAIL Multiple Cabinets Mounted on Interior WallExterior Mounted Cabinet(feet provided by mfr)View Inside AerationCabinet (2 compressors)SHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.com1" = 1'-0"SCALE:3/8" = 1'-0"SCALE:La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202503-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 733 1'-0" MIN.CPIPETRENCH WIDTHPER DETAILLK4.3BLENGTH TOFIT REQ'DBLOCK AREAT E EELBOW C A P WIDTH TO FIT REQ'D BLOCK AREA LENGTH TO FIT REQ'D BLOCK AREA WIDTH TOFIT REQ'DBLOCK AREAWIDTH TOFIT REQ'DBLOCK AREALENGTH TOFIT REQ'DBLOCK AREAT Y P I C A L S E C T I O NGENERAL NOTES1. TABLE IS BASED ON 2000lb/ft² SOIL BEARINGALLOWANCE. IF CONDITIONS ARE FOUND TOINDICATE SOIL BEARING IS LESS, THE AREASSHALL BE INCREASED ACCORDINGLY.2. AREAS FOR PIPE LARGER THAN 18"dia. SHALL BECALCULATED.3. CONCRETE SHALL HAVE A MINIMUMCOMPRESSION STRENGTH OF 2000psi.4. THRUST BLOCK IS TO EXTEND TO UNDISTURBEDSOIL.5. SIZE MAY BE DECREASED FOR LESSER DEGREEBENDS AS DETERMINED BY THE ENGINEER.6. KEEP CONCRETE CLEAR OF BELL AND SPIGOTJOINTS.7. BLOCK IN SIMILAR MANNER AT TEES, HYDRANTS,PLUG OR OTHER LOCATIONS AS REQUIRED8. IF CONCRETE BLOCKS CANNOT BE POURED,THEN USE TIE-RODS OR OTHER APPROVEDMETHOD TO RESTRAIN THRUSTPIPESIZEWATER PIPETEE, CAP,90° BENDS45° & 22.5°BENDS3 FT²4 FT²6 FT²9 FT² 5 FT²7 FT²12 FT²15 FT²13 FT²23 FT²29 FT²4" & LESS6"8"10"12"16"18"THRUST BLOCK AREAREQUIREMENTSNOTE:C O N T R A C T O R S H A L LPROVIDE THRUST BLOCKSF O R A L L I N G R O U N DPIPING 4"dia. AND LARGER3 FT²3 FT²3 FT²AROUND4" MIN.ALLBox Color:USE GREEN COLORED BOX INGRASS AREAS AND LIGHT BROWNCOLORED BOX IN SOIL AREAS"CARSON" MODEL910-2B BOLT DOWNLID"CARSON" PLASTICVALVE BOX MODEL#910-1CUT HOLE IN BOX BOTHENDS TO FIT OUTSIDEDIAMETER OF PIPELINE1"dia. PVC BALL VALVE PER"HAYWARD" SAFE BLOCKTRUE UNION WITH UNIONFITTINGS BOTH ENDSINTEGRAL1" LONG X 1"dia. PVCNIPPLE1" X 1/2"dia. PVCREDUCERCONNECT WEIGHTEDAERATION HOSE TOREDUCER WITH S.S.CLAMP - RUN WEIGHTEDHOSE IN 2"dia. PVCSLEEVE TO LAKE (NOTSHOWN HERE)RUN NON-PERFORATEDWEIGHTED HOSE PER"HINDE" OR APPROV.EQ. TO AERATION DISKIN LAKE BOTTOMBACKFILL AGAINSTBOX WITH "CLEAN"BACKFILL OR SANDPROVIDE 4" (MIN.) THICKLAYER OF GRAVEL ORCRUSHED ROCK ASSHOWN AS DRAIN2'-0"APP R O X . 3'-0" W I D E5'-0" LONG4'-0" APPROX.2'-0" APPROX.3/4" THICK PVC PLATE - ATTACH TOUNDERSIDE OF EACH LEG WITH 2"LONG STAINLESS STEEL SCREWSCONNECT WEIGHTED HOSE TODIFFUSER STUB-OUT HEREALTERNATE DIFFUSERTHE LAKE CONTRACTOR SHALL BID THISDIFFUSER AS AN ALTERNATE TOTHOSE DIFFUSERS SHOWN ON PLANCONNECT WEIGHTED HOSE ATOTHER END TO VALVE IN VALVEBOX WHERE SHOWN ON PLAN VIEWInformation and Sales Contact:www.bioboost.cajody@bioboost.cadavid@bioboost.caph: 905-830-5555 fax: 905-830-55259" MIN.4" MIN.6"MIN.4" MIN.CLEARCPIPECPIPE9" MIN.4" MIN.TRENCH WIDTHTO FIT PIPE SIZES4" MIN.CLEARCPIPECOMPACTED NATIVES O I L ( R O C K F R E E )COMPACTED NATIVES O I L ( R O C K F R E E )4" MIN.CLEAR4" MIN.CLEARTRENCH - SINGLE PIPETRENCH - MULTIPLE PIPEBANOTE: TRENCH BACKFILLSHALL CONFORM TO ASTMD2321 UNLESSOTHERWISE APPROV. BYTHE WATERFEATUREENGINEERNote:4" MIN. THICK SAND FOUNDATIONREQUIRED WHERE EXCAVATEDTRENCH BOTTOM CONSISTS OF SHARPEDGES OR RIDGES OR HAS HIGHPOINTS OF LOCALIZED LOADINGSWHICH MAY PUNCTURE THE PIPE ASDETERMINED BY THE WATER FEATUREENGINEER IN THE FIELDTOTAL TRENCH DEPTHBACKFILL SHALL OCCUR IN 6"LIFTS AND SHALL BECOMPACTED TO 90% RELATIVECOMPACTION (ALL TRENCHES)TRENCH WIDTHTO FIT PIPE SIZESSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comNONESCALE:NONESCALE:1-1/2" = 1'-0"SCALE:NONESCALE:La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 734 Pump Station Notes:1. THE TRANSFER SYSTEM PUMP(S) SHALL BE PER MODEL, SIZE, HORSEPOWER, ETC.SHOWN ON THE "PUMP LIST" ON THIS DETAIL. THE PUMP SHALL BE VERTICALLYMOUNTED ON A PRE-FAB SCREENED STEEL BASE INCLUDING STEEL THREADEDDISCHARGE SUPPLIED BY THE PUMP MFR. THE PUMP SHALL BE LOOSELY SET ON THEFLOOR OF THE VAULT AS SHOWN.2. THE LAKE CONTRACTOR SHALL INCLUDE AS A PART OF THE PUMP STATION WORK,ELECTRICAL HOOK-UP OF ALL ELECTRICAL COMPONENTS INSIDE THE PUMP STATIONAS DEPICTED ON THIS DETAIL. THE WORK SHALL BE PREFORMED IN ACCORDANCEWITH THE N.E.C. AND LOCAL CODES AND ORDINANCES AND BY A QUALIFIED LICENSEDELECTRICAL CONTRACTOR.3. ALL PVC PIPE SHOWN ON THIS SHEET SHALL BE SCH40 PVC OR BETTER WITH MFRPROVIDED SOLVENT WELD FITTINGS UNLESS OTHERWISE SHOWN OR UNLESSOTHERWISE SUPPLIED BY THE MANUFACTURER OF THE MATERIALS.4. THE PUMPS, CONTROLS AND PIPE FITTINGS SHOWN ON THIS DETAIL SHALL BECONSTRUCTED BY A LAKE CONSTRUCTION COMPANY FAMILIAR WITH THIS TYPE OFPUMP AND SYSTEM CONTROLS AND SHALL INCLUDE PUMPS, VALVES, FITTINGS,CONTROLS, WIRING AND ELECTRICAL HOOK-UP TO MAKE A COMPLETE ANDOPERATIONAL TRANSFER PUMP SYSTEM CAPABLE OF DELIVERING THE FLOWS ATTHE PRESSURE INDICATED ON THESE PLANS. THE PRE-FAB PUMP VENDOR SHALLPREPARE SHOP DRAWINGS FOR APPROVAL BY THE LAKE ENGINEER PRIOR TO STARTOF PUMP FABRICATION. SHOP DRAWINGS AND SUBMITTALS SHALL INCLUDE DATACUT SHEETS FOR ALL COMPONENTS AND A STRUCTURAL DRAWING FOR PUMPMOUNTING.5. THE PUMP STATION WET WELL SHALL BE PRE-FABRICATED POLYETHYLENE WITHGRADE RING AND GRATE COVER AS REQUIRED TO ACHIEVE THE INSIDE HEIGHTDIMENSION SHOWN. THE WET WELL, GRADE RING, GRATE COVER AND LATERAL PIPECONNECTION SHALL BE PER "ADS NYOPLAST" OR LAKE ENGINEER APPROVED EQUAL.CONTACT: PH: 770-632-2443, www.adspipe.com.THE CONTRACTOR SHALL INCLUDE:A. PRE-FAB GRATE COVER CUT TO FIT OPENING SHOWN. THE GRATE SHALL BESET IN A SINGLE PIECE WITH A SLOT CUT TO RECEIVE THE DISCHARGE PIPE.THE GRATE SHALL BE BOLTED DOWN TO THE TOP OF THE WET WELL USING THEBOLT-DOWN ADAPTER PROVIDED BY THE GRATE MANUFACTURER.B. PIPE CONNECTION HOLES AT EACH PIPE PENETRATION WITH A DIAMETEREQUAL TO THAT SHOWN ON THIS PLAN AND FITTED WITH A MANUFACTURERSUPPLIED SLEEVE TO CONNECT TO THE PIPE SHOWN.C. KNOCKOUTS OR HOLES TO RECEIVE THE ELECTRICAL CABLE TO SUPPLYPOWER TO THE PUMP WHERE CALLED FOR ON THIS DETAIL.THE WET WELL VENDOR SHALL PREPARE SHOP DRAWINGS FOR THE WET WELL,GRATE, GRATE SUPPORT AND LATERAL PIPE CONNECTION FOR APPROVAL BY THELAKE ENGINEER PRIOR TO FABRICATION.6. ALL MFR'S PRODUCT CALLOUTS SHOWN ON THESE PLANS SHALL BE CONSIDERED"OR LAKE SYSTEM ENGINEER APPROVED EQUAL" UNLESS OTHERWISE NOTED. THELAKE SYSTEM CONTRACTOR SHALL SUBMIT MFR'S PRODUCT DATA SHEETS FORAPPROVAL BY THE LAKE SYSTEM ENGINEER PRIOR TO ORDERING MATERIALS.7. THESE DRAWINGS REPRESENT THE FINISHED FACILITY, THEY DO NOT INDICATETHE METHOD OF CONSTRUCTION. THE LAKE SYSTEM CONTRACTOR SHALL PROVIDEALL MEASURES NECESSARY TO PROTECT THE SURROUNDING FACILITIES DURINGCONSTRUCTION. SUCH MEASURES SHALL INCLUDE, BUT NOT LIMITED TO, BRACING,SHOREING, ETC. FOR LOADS DUE TO CONSTRUCTION EQUIPMENT, ETC.LAKEWATERSURFACEEL. +353.00LAKELINER EL.+344.00(VERIFY)7'-6 5/16" 16'-5 3/8"PIPE INV.EL.+345.50(VERIFY)1'-9"WETWELLFIN.FLOOREL.+343.75(VERIFY)6'-0"2'-6"1'-8"1'-8"1'-0" 5'-2"1'-4"TOP OFWET WELLEL. +360.20(VERIFY)7'-2 3/8"FLOW 6"dia. 8"dia.FLOW8"dia. DISCHARGE PIPETO LOCATION SHOWNON PLAN VIEWLAKEPump List....PUMPSERVICE MANUFACTURER / MODEL # CAPACITY HP TURBINE# PH/VOLTS/HZTRANS-FER575gpm@ 35' tdh10CP06-160-1 1/240/60CARRY PUMPS STAINLESS STEELSUBMERSIBLE VERTICAL TURBINEFLOW PUMP MODEL#CP06-0100-231-T5'-3"3'-3"1'-4"8'-2"2'-6" WET WELL1'-8"1'-0"EQUALEQUAL5'-3" 3'-3"8'-2"2'-11"3'-3"8'-2"2'-6" WET WELL1'-8"1'-2"WETWELLWETWELLWET WELLFLOWSecPump Station Plan ViewPump Station Cross SectionPump Curve & DimensionsUNDER-DRAIN1'-6"MODELNOTESMANUFACTURERSYMBOL# ITEMTYPE12345678CHECKVALVECHECKVALVEBUTTERFLYVALVEBALLVALVE90deg ELLREDUCERBUSHINGWAFER TYPE E.I. &BRONZE EPDM SEATSCH 80 SPRINGLOADEDWAFER TYPE E.I. &BRONZE EPDM SEATSCH 80 PVC - COMPRFITTINGS BOTH ENDSSCH 80 PVC SOLVENTWELDTUFSKIN, INC.www.universalsales.bizSEKISUI IND. PIPINGwww.si-valve.comTUFSKIN, INC.www.universalsales.bizSEKISUI IND. PIPINGwww.si-valve.comDURAwww.duraflow.comCV SERIESITEM #CKBS SERIESITEM #80SIZE SHOWN w/ S.Snuts, bolts & washersSOLVENT WELD,BUNA-N, seal per planSIZE SHOWN w/ S.Snuts, bolts & washersSIZE SHOWN, inf.adjust, plastic handleUSE MFR RequiredPrimer, Solvent WeldFittings List . . . .SCH 80 PVC SOLVENTWELDDURAwww.duraflow.comUSE MFR RequiredPrimer, Solvent WeldSLIP / FLGADAPTERSCH 80 PVC - BOLT /SOLVENT WELDDURAwww.duraflow.comUSE MFR RequiredPrimer, Solvent WeldEQUALEQUALEQ.EQ.FLOWWET WELL INTAKEPIPE FROM LAKE(LINESIZE PER PLAN)65 m3/hr(285gpm) @ 5m(16.5') tdh3VFDREQ'D1/240/60CARRY PUMPS STAINLESS STEELSUBMERSIBLE VERTICAL TURBINEFLOW PUMP MODEL#CP04-0300-231-T3'-9"MIN. SUBMERGENCE Lake#16BAWET WELL INTAKEPIPE FROM LAKE(LINESIZE PER PLAN)8"dia.SEAL INTAKE PIPE TO WET WELLWALL WITH COLLAR PROVIDEDBY THE WET WELL MFRTRANSFER PUMP AS CALLEDOUT ON TABLE (THIS DETAIL) -SET LOOSELY ON WET WELLFLOORBOLT DOWN COVERGRATE PROVIDED BYTHE WET WELL MFR -CUT U-SHAPED SLOTTO RECEIVEDISCHARGE PIPETRANSFER PUMP CONTROLPANEL AS PROVIDED BY THEPUMP MANUFACTURER8"dia.CONCRETE SLAB ASDETAILED ON CROSSSECTION (THISDETAIL)DASHED LINEINDICATESREQUIRED CLEARSPACE IN FRONT OFPUMP STATIONCONTROL PANEL PERCODETRANSFER SYSTEMPUMP CONTROLPANEL AS PROVIDEDBY THE PUMPMANUFACTURERAIR RELEASE VALVEPER DETAILLK6.1D6"THICK CONCRETESLAB (F'C = 2500PSIMINIMUM)REINFORCED WITH#4 BARS @ 300MM(12") O.C. EACH WAYTRANSFER PUMP ASCALLED OUT ONTABLE (THIS DETAIL) -SET LOOSELY ONWET WELL FLOORUSE LINESIZE SCH80PVC SLIP / THREADCOUPLING TOCONNECTDISCHARGE PIPE TOPUMP DISCHARGEUSE LINESIZE SCH80PVC DISCHARGE PIPERISERCONCRETE COLLAR(F'C = 2500PSIMINIMUM)REINFORCED WITH#4 BARS @ 12" O.C.EACH WAY TO SIZEAND CONFIGURATIONSHOWNWET WELL AS DESCRIBED IN PUMPSTATION NOTES - THE WET WELL WILLBE FABRICATED IN SECTIONS WITHCONNECTOR COUPLINGS SUPPLIED BYTHE VENDOR - CONTACT VENDOR FORSPECIFIC GUIDELINES FORINSTALLATION REQUIREMENTSWRAP GRAVELBACKFILL WITH ASINGLE LAYER OF 8OZ/SY GEOTEXTILEFABRIC ALL AROUNDWET WELLIF PIPE SIZE SHOWNON PLAN IS LARGERTHAN SHOWN HEREUSE REDUCERBUSHING TO MATCHAT THIS LOCATION(TYPICAL)8"dia. DISCHARGE PIPETO LOCATION SHOWNON PLAN VIEWWATERTIGHT BOTTOMSEAL PROVIDED BY THEWET WELL MFRSEAL INTAKE PIPE TOWET WELL WALL WITHCOLLAR PROVIDED BYTHE WET WELL MFRRUN POWER CORD TOCONTROL PANEL PERPUMP MANUFACTURER'SREQUIREMENTSBOLT DOWN COVERGRATE PROVIDED BYTHE WET WELL MFR -CUT U-SHAPED SLOT TORECEIVE DISCHARGEPIPETHE GRAVEL BACKFILLMATERIAL SHALL BECRUSHED STONE OROTHER GRANULARMATERIAL MEETING THEREQUIREMENTS OFCLASS II MATERIAL PERASTM D2321 - PLACEUNIFORMLY COMPACTEDTO 90% STANDARDDENSITY 6"dia.58"dia.757175ACCEPTABLEMOUNTING LOCATIONFOR AERATIONCABINET - SEE PLANFOR QUANTITYACCEPTABLEMOUNTING LOCATIONFOR AERATIONCABINET - SEE PLANFOR QUANTITYSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.com3/4" = 1'-0"SCALE:La Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 735 CLPIPEPIPE BOOT OF THE SAMEMATERIAL AS THE MEMBRANELINER TO BE PRE-FAB-RICATED BY THE LINERMFR - SEE DETAILCLEAR INTAKE PIPEINVERT ELEV.PER PLANWATER SURF. EL.PER PLANLK3.3 - INTAKE PIPE TO SIZE AND WHERELOCATED ON PLAN VIEW - EXTENDPIPE THRU LINER AND EARTHCOVER AS SHOWN TO SUPPORT SCREENPRE-FABRICATED STEEL BOXSCREEN SUPPORTED ON ENDOF INTAKE PIPE AS SHOWNON DETAIL SEE PLANFOR MORE INFORMATIONB-LAKE MEMBRANE LINER WITH PROTECTIVE COVERAS DESCRIBED IN LAKE SYSTEM GENERAL NOTESINTAKE PIPETO PUMP STATIONAS SHOWN ONPLAN VIEWCAREFULLY PREPARED LINERSUBGRADE AS DESCRIBED INLAKE SYSTEM GENERAL NOTES6"6"CL'R.6"2"EQUALEQUALEQUAL EQUAL TO FIT PIPE SIZESHOWN ON PLAN 2'-0"2'-0"2'-0"3/16" THICK STEEL PLATE ONSCREEN TOP, BOTTOM ANDAT CONNECTION TO PIPE -WELD ALL EDGECONNECTIONSL1-1/4 X 1-1/4 X 1/8STEEL POSTSINSIDE OF SCREENAT TWO FRONTCORNERS OFTHIS ASSEMBLY1/2" EXPANDEDWIRE MESH(3) SIDES ASSHOWN - WELDALL EDGESTO POSTS ANDSTEEL PLATEEDGESL1-1/2 x 1-1/2 X 1/8STEEL FRAMEAT PERIMETEROF ALL SCREENEDOPENINGS -WELD TO STEELPLATES ANDTO EACH OTHERAT ENDS - ALLENDS SHALLBE MITEREDSTEEL PIPE SLEEVESIZED TO FIT THIS OUT-SIDE DIAMETER OF THEINTAKE PIPE SHOWN ONTHE PLAN VIEWDRILL 3/4"dia. HOLEIN TOP OF SLEEVEAND TOP OF INTAKEPIPE - LOCK SCREENTO PIPE WITH LOOSE5/8"dia. S.S. PINALL WELDED EDGES SHALLBE GROUND SMOOTH AND THISENTIRE ASSEMBLY SHALL BEHOT DIP GALVANIZED AFTERFABRICATIONNote:ExistingPVCNew RPENew TITUSINDUSTRIALG-25 Tapeper specsbelowcenter tapeon this edge4" to 6"overlapAIR RELEASE VALVEBRONZE COVER PETCOCK PER"GRAINGER" ITEM# 5MYW1CONTACT:www.grainger.com/productAIR RELEASE VALVE SAMPLEPHOTODISCHARGE PIPETO SIZE SHOWNON PLANSCH 40 PVCSOLVENT WELDSADDLE (25mm(1") dia. xLINESIZE)SCH 40 PVCSOLVENT WELDREDUCERBUSHING (TOFIT VALVE)SCH 80 PVCCLOSE NIPPLE(TO FIT VALVE)AIR RELEASEVALVE - SEE AIRRELEASE VALVENOTE ON THISDETAIL FORMORE INFOSHEET TITLE:SHEET NO:P2122RAM / APMAS SHOWNDATE:REVISIONS:SCALE:PROJ. NO:DRAWN:LOS GATOS, CALIFORNIA LA RINCONADA COUNTRY CLUB06-19-2024Lake Plans for Submittal 06-19-2024Lake System Construction Drawings 2120 Megan Creek Dr.Little Elm, TX 75068714-321-2330 lakemaker@aol.com714-356-1400 lakemaker18@yahoo.comSCALE:NONESCALE:NONESCALE:NONELa Rinconada Golf Course Modernization Project 17400 WEDGEWOOD AVE & 17445 ZENA AVE, LOS GATOS, CA03-28-202503-28-202505-23-25 PER TOWN COMMENTS2Page 736 From: To:Ryan Safty Subject:LRCC-Tree Removal Date:Monday, March 31, 2025 11:07:21 PM [EXTERNAL SENDER] My concern regarding the Re-design of the La Rinconada CC is both the removal of 200 Trees as well as, the omissions & misleading approach by the Re-design Committtee who failed to mention the tree removals, until I asked at a membership meeting, how many trees were going to be removed. Sadly, this project is being told/sold to the citizens of Los Gatos as an Eco-Friendly project when in reality it is a project that is removing over 200 trees which is NOT necessary to save water (the eco- friendly angle). When the Committee was asked if the members could vote on more than 1 option: total golf course Re-design, or Option 2: install a new irrigation system and improved grass (less water requirement) the Golf Course Re-design committee generally said, No, this is our opportunity to improve this Golf Course and keep up with the other premier courses on the Peninsula/Bay Area. Because there has been some member push back, the Re-design Committee contacted: The Los Gatan, The Patch & The Mercury News and gave them the "Eco-Friendly angle, in an attempt to get community support. I have considered responding to their articles but am fearful that I will receive retribution at the club. As you may know, the club removed 12 healthy Redwoods with diameters of 4-5 feet without a LG Town permit (received a fine about $750- a small fine to pay for a $42 Million project) because the Committee said they were preventing grass from growing near the trees and Redwoods use a lot of water. However, Arborist, Rob Moulden whom I imagine you know, said that Redwoods in this area survive because we are in the Coastal Fog Line... I have Redwood trees on my property which I don't water... My hope is that the LG Planning Commission when considering this project will follow the Tree Protection Ordinance (Sections 29.10.0950-29.10.0985) policies on removal of trees especially Redwoods that are 60-80 years old and have become integral to the ecosystem of the neighborhood and town. LRCC is the largest Open Space in the town and has been in existence for over 100 years. These mature trees provide invaluable benefits, including air purification habitat for wildlife, and erosion control. Their absence will have a significant lasting impact on our local environment and alters the visual landscape that many residents cherish. These mature trees also offer a sound barrier to highway 85 for the communities of Los Gatos & Monte Sereno. There is a plan to replace some of the removed trees but with much smaller 24-48 inch box tress which will take decades to grow to the size of the removed trees. Thus, I urge the Planning Commission to seek alternative solutions that will preserve the healthy existing trees. Please notify me if and when this project will be placed on the Calendar for discussion by the Town Council.. Thanks for listening, Lisa Sieber EXHIBIT 12Page 737 From: noreply@civicplus.com <noreply@civicplus.com> Sent: Thursday, May 15, 2025 11:33 AM To: Planning <Planning@losgatosca.gov> Subject: Online Form Submission #15935 for Community Development Contact Form [EXTERNAL SENDER] Community Development Contact Form First Name Lisa Last Name Sieber Email Address (Required) Phone Number Tell Us About Your Inquiry (Required) Comment Regarding A Planning Project Address/APN you are inquiring About (Required) 14702 La Rinconada Dr., Los Gatos, CA 95032 Message (Required) This is NOT an ECO-FRIENDLY Project as reported... La Rinconada CC is the largest Open Space in the Town of Los Gatos and therefore should be on the Council Agenda so neighbors and Town residents may voice an opinion about the removal of 207 Mature, Healthy, Native Trees. Please provide me with the status of this project? Page 738 From: noreply@civicplus.com <noreply@civicplus.com> Sent: Thursday, May 15, 2025 2:52 PM To: Planning <Planning@losgatosca.gov> Subject: Online Form Submission #15938 for Community Development Contact Form [EXTERNAL SENDER] Community Development Contact Form First Name Ron Last Name Laugesen Email Address (Required) Phone Number Tell Us About Your Inquiry (Required) General Planning Inquiry Address/APN you are inquiring About (Required) 17400Wedgewood and 17445 Zena Ave Message (Required) Concerned that there are many large trees which could be removed, impacting the visual scene of the area, a major reduction in CO2 capture and major increase in noise, particularly from 85 and 17 freeways. Also substantial dust in the air while this project is in progress. Add An Attachment if applicable Field not completed. Page 739 From: noreply@civicplus.com <noreply@civicplus.com> Sent: Thursday, May 15, 2025 4:13 PM To: Planning <Planning@losgatosca.gov> Subject: Online Form Submission #15939 for Community Development Contact Form [EXTERNAL SENDER] Community Development Contact Form First Name Judith Last Name Marlin Email Address (Required) Phone Number Field not completed. Tell Us About Your Inquiry (Required) Comment Regarding A Planning Project Address/APN you are inquiring About (Required) 17400 Wedgewood Message (Required) 170 trees to be removed? When Inhas to remove a tree from my property I has to replace it either or my property or elsewhere in town. But how does one replace 170 MATURE trees? Surely this huge number is not necessary. Loss of the O2 and CO2 exchange is HUGE, not to mention their purpose as wikdlife habitats. This seems entirely,y too extreme. Add An Attachment if applicable Field not completed. Page 740 Page 1 of 3 July 13, 2025 The Honorable Members of the Los Gatos Town Council Town of Los Gatos 110 East Main Street Los Gatos, CA 95030 (via email: council@losgatosca.gov) RE: Our Support for La Rinconada Country Club’s Golf Course Modernization and Sustainability Project Dear Mayor Hudes & Councilmembers, We are long-time members of La Rinconada Country Club and also neighbors who live near the golf course. We are joining together to let the Town’s leaders know of our early and strong support for the Club’s proposed modernization and sustainability project which we understand will come before the Planning Commission for consideration later this summer. These progressive improvements will make the golf course more playable, sustainable and safer for future generations and are important to the entire community. La Rinconada is one of the most time-honored organizations in Town, which was founded almost 100 years ago, and we want the Club to continue for another century. The course modernization project is an important step toward ensuring the Club’s long- term viability, and it has overwhelming support of Club members who will be paying for the $21 million cost through special assessments. The plan is about more than just enhancing the golfing experience; it's about securing a sustainable future for the course and community and deepening the Club’s commitment to environmental stewardship. At the heart of this initiative is an ambitious goal to reduce overall water consumption by 30%. This is a direct response to the Club's responsibility to conserve precious resources and contribute positively to regional water sustainability efforts, saving more than 30 million gallons of water per year. Page 741 Page 2 of 3 Beyond state-of-the-art irrigation technology and new drought-tolerant turfgrass, the plan also addresses the crucial role of landscaping in water conservation and ecological health. To truly maximize water savings and enhance the course's natural resilience, the plan includes the strategic removal of many non-native trees that are simply not drought tolerant. These trees, while often beautiful, require significant water resources that are unsustainable in our environment over the long term. This isn't a decision to be made lightly, but it's essential for long-term water conservation and overall safety and is coupled with an extensive and ambitious replanting initiative focused on native, drought- tolerant trees and plants. This will not only dramatically reduce the course’s water needs but also create a more ecologically balanced and resilient landscape that thrives naturally in our climate. Many golf courses in the region have gone through similar sustainability initiatives in past years, including new drought tolerant grass, water reduction, tree removal and replanting, with the support of their local government, and we hope Los Gatos will do the same. The Club’s leadership has maintained a great relationship with its neighbors over many decades and has worked hard to share information about this proposed modernization plan, contacting more than 800 nearby homes by letter early in the process, holding a half dozen open houses, and meeting one-on-one with many neighbors. The Club’s membership includes over 250 families who live in Los Gatos and another 100 in nearby Monte Sereno. We understand communications from a couple neighbors have been submitted to the Town which do not express the wishes of the vast majority of Club members, nor most of our neighbors. They have also engaged in circulating inaccurate information about the Club’s proposal. We ask Town leaders to focus on the facts and benefits of the modernization and sustainability plan for the Club and our Town. We also hope you will take note that the many families signing this letter represent even more members of our community who overwhelmingly support the Club’s proposal to tee up a greener future for golf in Los Gatos! Sincerely, MEMBERS AND NEIGHBORS OF LA RINCONADA COUNTRY CLUB Page 742 Page 743 Page 744 Page 745 Page 746 Page 747 Page 748 Page 749 Page 750 Page 751 Page 752 Page 753 Page 754 Stephen M. Rice Los Gatos, CA 95030-7131 Planning Commission Town of Los Gatos 110 E. Main Street Los Gatos, CA 950390 Re: Application S-25-005 – La Rinconada Country Club Renovation Project Commissioners: I am a former Planning Commissioner, Council Member and Mayor. I am also a member of La Rinconada and serve on the committee for this project. I have been playing golf at La Rinconada since the 1960’s and have seen the club and course go through many changes. It is my belief that this project epitomizes the Town’s sustainability initiatives and benefits the Town in many ways. The application is completely in line with the Town’s tree protection policies as I applied those policies when I served on the Commission and Council. There has been limited and isolated concerns expressed about the reforestation portion of the application. The independent Arborist’s report demonstrates that La Rinconada took a very cautious and conservative approach to this particular area. In the plan, the club proposes the removal of several Eucalyptus trees and non-native Redwood trees. With a planned significant reduction of irrigation, these trees, if not removed, will present a danger to players and employees and present a fire danger to the community at large. The vast majority of these trees will be replaced with large, mature native species – primarily native oak trees – and an additional contribution to the Town’s Urban Reforestation program. The golf course renovation plan will include turf-grass replacement, which will replace the current grasses with drought-tolerant grasses, requiring 30% - 40% less water than is used currently. A state-of-the-art irrigation system will allow for more precise watering patterns, further saving this precious resource. Many other clubs in the area have undergone similar turf-grass replacement with significant decreases in potable water use. The new grass is also more tolerant of salt and other contaminants present in recycled water, should that become available for use in the future. Page 755 The club has taken great care to engage the community and other stakeholders in the process of planning the project. Special measures have been taken to minimize, or even eliminate, impacts on the surrounding neighborhoods during construction. With the strong arguments that favor the approval of this application, I ask that you support the La Rinconada renovation project. Respectfully Submitted, Steve Rice Page 756 From: To: Subject:Urgent Request: Add Petition to Agenda – Protection of 287 Mature Trees at LRCC in Los Gatos Date:Wednesday, August 6, 2025 2:05:03 PM Attachments:save-240-mature-trees-in-los-gatos-monte-sereno-help-protect-the-largest-open-space-in-los-gatos (1).pdf signatures-20250806.csv [EXTERNAL SENDER] Dear Members of the Los Gatos Town Council and Town Clerk, On behalf of a growing group of concerned Los Gatos residents, I am submitting the attached petition titled “Stop the Irreversible Destruction of 240 Mature Trees in Los Gatos”, along with a list of resident signatures collected in support of this effort. We respectfully request that this matter be added as an urgent item for public discussion at the next Town Council meeting, and that time be allotted for a representative of the petition to speak on behalf of the signatories. The matter is time-sensitive, as the plan by La Rinconada Country Club to remove 240 mature trees is already in advanced stages, and the full environmental impact has not been adequately addressed or disclosed to the public. We are particularly concerned that the ecological report submitted by La Rinconada Country Club contains misleading and potentially false representations regarding the health, species, and condition of the trees proposed for removal. Our own observations and those of local environmental professionals indicate that many of these trees are in good condition and pose no imminent safety risk. The justification for removal appears to be driven primarily by a design initiative and water conservation, rather than ecological necessity or public safety. We are formally requesting that the Town of Los Gatos commission an independent, third-party environmental assessment to verify the actual condition of the trees and assess the broader environmental implications of this proposal. An impartial evaluation is essential before any irreversible action is taken that would permanently alter our community’s landscape, air quality, wildlife habitat, and character. Further, we note that La Rinconada Country Club has previously engaged in unauthorized tree removals without permits, and failed to disclose such actions to the Town. This pattern of non-compliance and lack of transparency raises serious concerns about the integrity of the current proposal and the credibility of their reporting. Additional points of concern include: Misidentification of tree species, including incorrect classification of healthy native trees as non-native or invasive (e.g., eucalyptus). Unsubstantiated claims of storm damage, with no supporting evidence or Page 757 public record of fallen or hazardous trees. A lack of clear disclosure of the long-term environmental and community impact of this large-scale removal. Given the scale of this proposed removal and the Town's stated commitment to environmental stewardship, climate resilience, and community involvement, we urge you to take this petition seriously and act swiftly to pause any approvals until independent findings can be reviewed in a public forum. Thank you for your attention to this urgent and deeply impactful matter. We look forward to your confirmation that this item will be added to the upcoming Town Council agenda and that an opportunity to speak will be granted. Sincerely, Lisa Sieber On behalf of the petitioners of “Stop the Irreversible Destruction of 240 Mature Trees in Los Gatos” Attachments: Stop_the_Irreversible_Destruction_of_240_Mature_Trees_Petition.pdf List_of_Supporting_Signatures.csv Page 758 ÿ Stop the Irreversible Destruction of 240 Mature Trees in Los Gatos To: La Rinconada Country Club members, Los Gatos Residents, arborists, naturalists, and conservationists The proposed removal of 240 mature trees is not just a landscaping decision 4 it is an environmental threat with lasting consequences for the entire community. These trees are a living infrastructure that support ecological balance, climate stability, and public health. Scientific and Environmental Impact: 1. Loss of Tree Canopy 3 These trees purify air, sequester carbon, reduce noise, and provide essential shade. Their removal will measurably increase air pollutants and heat levels. 2. Wildlife Displacement 3 Birds, pollinators, and small mammals rely on this established habitat. Destroying it means mass displacement and ecological disruption. 3. Increased Fire Risk & Heat 3 Mature trees act as a buffer against climate extremes. Their removal will elevate local fire risk and contribute to the urban heat island effect. 4. Soil Degradation & Runoff 3 Removing deep-rooted trees will destabilize soil, leading to erosion, increased runoff, and waterway pollution. 5. Public Health Consequences 3 Trees improve mental health, lower stress, and are vital to respiratory health 4 particularly for children, seniors, and those with asthma or COPD. Why is this important? La Rinconada Country Club and Los Gatos City Council - This is not just a golf course issue. These trees are part of our town’s ecological fabric and legacy. Removing them undermines decades of environmental growth and community investment. ' We Demand Immediate Action: 1. A full pause on all tree removals pending review. 2. A second, independent arborist report to verify the necessity of removals. 3. Transparent public consultation before any further action is taken. 4. Alternatives to tree removal that prioritize sustainability and long-term environmental health. We acknowledge the need to modernize irrigation and reduce water use, but replacing 240 trees 4 many over 60 years old 4 with grass is not an ecological solution. It’s a short-sighted tradeoff with permanent consequences. ÿ Sign the petition now to protect our community’s green lungs. Together, we must demand transparency, science-based decisions, and responsible stewardship of our shared environment. Every signature counts. Signed by 109 people: Page 759 id first_name last_name postcode comment 325288954 lisa sieber 95032 325290518 Lisa Sieber 95032 325344349 Mags McInerney 95030 325426283 Cathy Call 95030 325602244 Tiffany Sieber 95030 325605697 Dean Tajik 95032 325635688 Teresa Lasaga 95032 325641468 cassandra joseph 95032 325648441 sunny hernandez 95032 325655549 Barbara Meyer 95125 325664206 Anne Plane 95030 325664790 Penny Alexa 95035 325665246 Megan McNally 95032 325720682 Margaret Williams 95125 325725896 Yu Ting Huang 95039 325738948 Jason Atchison 94024 325834357 Glynn Lewis 95032 325843323 Kylie Hall 80132 325851832 Ujjal Kohli 95070 325851896 Paige Shand 95030 325851939 Cheri Johnson 95030 325852003 Phil Arney 95030 325852011 Laura Tillett 95070 325852072 KELLY ARONICA 95008 325852087 David Rivas 94086 325852163 Lotus Mahon 95032-1146 325852224 Barbara Stake 95125 325852231 Leslie Matteoni 95128 325853559 Roger Milton 95030 325853692 Jill Milton 95030 325853777 Daniela Rogers 95032 325854793 Minio Bakke 95070 325856597 Jennifer Liu 95030 325866604 Ryan Greco 95032 325869473 Elizabeth Twaddell 95030 325871090 Sue Nystrom Walsh 95030 325871327 Lucille Switzer 95032 325871543 Martin Saso 95117 325872805 Tessa Arguijo 95030 325872891 Allen Arguijo 95030 325877278 John Hogan 95030 325883031 Bradley Jennings 95008 325883470 Gary McNeal 95032 Page 760 325883765 Maureen Howard 95066 325884447 Patrice Flageollet 95032 325897851 Cliff Geddes 95030 325899821 jeff hopkins 95032 325901799 Sharon Elder 95032 325902109 Aubrie Avina 95033 325954782 Kirsten Franz 95032 326074783 Michelle Collins 6517 326164600 Scott Eschen 95030 326207108 Shamita Pisal 95032 326300382 Jennifer Almaneih 95030 326475219 Timothy Lundell 95030 326475315 Justin Sieber 95032 326480097 Keo King 95032 326480335 Ginger McDonald 95032 326484464 Ann Rice 95030 326487140 Miriam Brody 95030 326487183 susana craig 95030 326487444 Larisa Dorfman 95032 326487565 Judith Marlin 95032 326494064 Isabella Rennie 95030 326539829 scott caplener 95030 326547611 Paulette DAVIS 95124 326565384 Bruce Wayne 95051 326565424 Sadie Hawkins 95111 326565711 Jeanette Belser 95032 326565858 Amrito Chaube 98125-3826 326567026 Alison Walton 95032 326591659 Melany Moore 95030 326597710 Lorraine Lawson 95008 326598611 Dan Lawson 95008 326599485 Cindy Simon 95003 326599504 Vickie Menkemeller 95128 326620341 Harry Dunn 43123 326626155 darrell monda 95032 326626180 Ted Striker 90045 326627956 Anita RobinStreicker 95030 326659351 Kevin Camara 95030-3235 326681808 Wendy Novakovich 95070 326847403 shannon mcelyea 95070 326847638 JoAn Smith 95032 326847665 Pamela Ross 95032 326847798 Michael Egleston 95130 326847943 Michael Hyman 95030 Page 761 326848070 Joe Pirzynski 95032 326860143 Alice Chan 95070 326888908 Stephen Guruwaiya 95126 327013192 Teri Christensen 95030 327192524 Barbara Alford 95030 327199150 Lorena Stepp 96793-9666 327201822 Alison Haazer 94019 327208085 Irene Rhodeman 92869 327208186 Anela Rhodeman 92869 327208315 Shirley Gines 96797 327208353 Tim Cox 94062 327211111 Matt Vaughan 95128 327221125 Carol Waitte 95030 327221308 Carol Braham 95030 327225028 Maureen Cappon-Javey 95030 327228291 Sarah Zweng 95030 327228317 Shannon Susick 95030 327228471 Ann Wilson 95030 327247994 Nancy Lee 95030 327273949 Homer Simpson 90010 327328666 Lynn RAMIREZ 94566 327347020 Werner Frei 95030 Page 762 From: Sent: Thursday, August 7, 2025 6:27 PM To: Planning <Planning@losgatosca.gov> Subject: Tree removal by La Rinconada CC [EXTERNAL SENDER] Please look into this. Darrell Darrell Monda Page 763 From: Sent: Thursday, August 7, 2025 6:27 PM To: Planning <Planning@losgatosca.gov> Subject: La Rinconada plan to cut down trees [EXTERNAL SENDER] Please review and see if this can be stopped. Darrell Darrell Monda Page 764 From: Andrew Quan Sent: Friday, August 8, 2025 10:52 AM To: Planning <Planning@losgatosca.gov> Cc: Lisa Brancatelli Subject: Valley Water Comments re: Redevelopment of the La Rinconada Golf Course [EXTERNAL SENDER] Hi Ryan Safty, Valley Water has reviewed the mailed plans for the consideration of approval of a grading permit and removal of large protected trees associated with a comprehensive redevelopment of the La Rinconada Golf Course located in the Town of Los Gatos, received on August 4, 2025. Per our review, we have the following comment: 1. Please note that there appears to be proposed improvements within Valley Water’s easement for our Rinconada Force Main and possibly within Valley Water’s fee title property consisting of our Vasona Canal. Said improvements include, but may not be limited to, a 6-inch storm drain line, a rock headwall and outfall, and two 12-inch RCP culverts with concrete case. Therefore, in accordance with Valley Water’s Water Resources Protection Ordinance, a Valley Water encroachment permit is required for the proposed improvements and plans must be submitted for permit review and issuance. The encroachment permit application can be found here: https://www.valleywater.org/contractors/doing-businesses-with-the- district/permits-working-district-land-or-easement/encroachment-permits. Please forward the completed permit application and construction plans for the project to Valley Water at CPRU@valleywater.org for review. For the to-be-submitted construction plans, please clearly delineate and label Valley Water’s easement and fee title property, the Vasona Canal, and the Rinconada Force Main. Additionally, please clearly identify any proposed improvements crossing or adjacent to Valley Water’s facilities, fee, and easement. 2. Please note that grading on the project site needs to be designed in such a way that drainage is directed away from Valley Water’s easement, fee title property, and Smith Creek. Runoff from the site needs to be directed to the Town of Los Gatos’ storm drain system, not to the creek by overland or through a new outfall. Page 765 3. Valley Water records indicate that 3 active wells are located on the subject property. If the wells will continue to be used following permitted activity, they must be protected so that they do not become lost or damaged during completion of permitted activity. If the wells will not be used following permitted activity, they must be properly destroyed under permit from Valley Water. While Valley Water has records for most wells located in the County, it is always possible that a well exists that is not in Valley Water’s records. If previously unknown wells are found on the subject property during development, they must be properly destroyed under permit from Valley Water or registered with Valley Water and protected from damage. For more information, please call Valley Water’s Well Ordinance Program Hotline at 408-630-2660. For any questions, please contact me at or at . For any future correspondence, please reference File No. 22077. Thank you, ANDREW QUAN ASSISTANT ENGINEER II - CIVIL Community Projects Review Unit VALLEY WATER 5750 Almaden Expressway, San Jose CA 95118 www.valleywater.org Page 766